Align Cystathionine gamma-synthase; CGS; EC 2.5.1.48; O-succinylhomoserine (thiol)-lyase (uncharacterized)
to candidate WP_092995230.1 BLP65_RS08235 PLP-dependent aspartate aminotransferase family protein
Query= curated2:Q1M0P5 (380 letters) >NCBI__GCF_900102855.1:WP_092995230.1 Length = 394 Score = 283 bits (724), Expect = 6e-81 Identities = 168/390 (43%), Positives = 232/390 (59%), Gaps = 13/390 (3%) Query: 1 MHMQTKLIHGGISEDATTGAVSVPIYQTSTYR---QDAI-----GHHKGYEYSRSG-NPT 51 MH+ T+ +H G +DA G+ P+Y T+T++ +AI G G Y+R G NPT Sbjct: 7 MHLATRCVHAGELDDAQ-GSPHTPLYTTTTFKFASTEAILDVVEGRAAGSLYTRYGLNPT 65 Query: 52 RFALEELIADLEGGVKGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNKVLVK 111 +LE +A LEG FAF SG+A A+F L + V+ D YGGT L L Sbjct: 66 IQSLEAKLASLEGAEAAFAFCSGMAAETALF-LAYGREGVVCIGDAYGGTLELLADQLPL 124 Query: 112 NGLSCTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDN 171 G+ +I S+L +++ + + ++LETP+NP L++ DLA A A HG L VDN Sbjct: 125 FGIDTHLILGSELDRLEDLLAGGARLVFLETPTNPALEVFDLAAIAEKAHAHGALLAVDN 184 Query: 172 TFATPYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLG 231 TFA+P Q PL LGAD VHS TKYLGGHSD+ AG + + E LA + +N +G + Sbjct: 185 TFASPVNQQPLALGADFAVHSATKYLGGHSDLTAGALMGSQELLAPIFGWRKN-LGSMPA 243 Query: 232 PQDSWLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMR 291 P+ LL R ++TL +R++ +A VAE +++HP+V RV YPGLP P ++LA KQM Sbjct: 244 PETCNLLARSLRTLVVRVRQQNASAQAVAEAMQRHPRVRRVLYPGLPDFPGHDLAAKQMS 303 Query: 292 GFSGMLSFTLKNDSEAT-PFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAG 350 GF GML+ + D+E T V+ LKLF + SLGG ESLV P TH + +T+RE G Sbjct: 304 GFGGMLTIEVDADTEGTAAVVDRLKLFAIAPSLGGAESLVTQPVTTTHHGLSETERERRG 363 Query: 351 IRDGLVRLSVGIEHEQDLLEDLEQAFAKIS 380 I +VRLSVG+E +DL+ DLEQA + S Sbjct: 364 INGAMVRLSVGLEDAEDLIADLEQALSVAS 393 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 394 Length adjustment: 30 Effective length of query: 350 Effective length of database: 364 Effective search space: 127400 Effective search space used: 127400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory