Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_092995230.1 BLP65_RS08235 PLP-dependent aspartate aminotransferase family protein
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_900102855.1:WP_092995230.1 Length = 394 Score = 234 bits (597), Expect = 3e-66 Identities = 141/383 (36%), Positives = 211/383 (55%), Gaps = 6/383 (1%) Query: 18 ATQAIRGGTARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYSRLQ-NPTVEML 76 AT+ + G G L+ T+ + + G G Y+R NPT++ L Sbjct: 10 ATRCVHAGELDDAQGSPHTPLYTTTTFKFASTEAILDVVEGRAAGSLYTRYGLNPTIQSL 69 Query: 77 EQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGI 136 E ++A LEGAEA A SGMAA TA L G IG A+G L QLP FGI Sbjct: 70 EAKLASLEGAEAAFAFCSGMAAETALFLAYGREGVVCIGD--AYGGTLELLADQLPLFGI 127 Query: 137 ETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAFA 196 +T ++ + + D + ++ F ETP NP ++V DL A+ A G + VDN FA Sbjct: 128 DTHLILGSELDRLEDLLAGGARLVFLETPTNPALEVFDLAAIAEKAHAHGALLAVDNTFA 187 Query: 197 TPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHRNTGPTLSPFN 256 +P Q+P+ GAD +SATK + G + AGA+ G++E + + + +N G +P Sbjct: 188 SPVNQQPLALGADFAVHSATKYLGGHSDLTAGALMGSQELLA-PIFGWRKNLGSMPAPET 246 Query: 257 AWVVLKGLETLDLRIQRQSENALKVARFLEG--RVPRVNFPGLPSHPQHNLAMSQMAAAG 314 ++ + L TL +R+++Q+ +A VA ++ RV RV +PGLP P H+LA QM+ G Sbjct: 247 CNLLARSLRTLVVRVRQQNASAQAVAEAMQRHPRVRRVLYPGLPDFPGHDLAAKQMSGFG 306 Query: 315 PIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVGE 374 + +IE+D ++D L L I+ ++G + SL+T P +TTH G++E +R G+ Sbjct: 307 GMLTIEVDADTEGTAAVVDRLKLFAIAPSLGGAESLVTQPVTTTHHGLSETERERRGING 366 Query: 375 GMLRLNVGLEDPEDLIADLDQAL 397 M+RL+VGLED EDLIADL+QAL Sbjct: 367 AMVRLSVGLEDAEDLIADLEQAL 389 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 394 Length adjustment: 31 Effective length of query: 371 Effective length of database: 363 Effective search space: 134673 Effective search space used: 134673 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory