Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_092995230.1 BLP65_RS08235 PLP-dependent aspartate aminotransferase family protein
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_900102855.1:WP_092995230.1 Length = 394 Score = 258 bits (658), Expect = 3e-73 Identities = 143/382 (37%), Positives = 217/382 (56%), Gaps = 3/382 (0%) Query: 21 TLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRY-TNPTVRTFE 79 T V AG+ +G L+TT+++ F + G G++Y+RY NPT+++ E Sbjct: 11 TRCVHAGELDDAQGSPHTPLYTTTTFKFASTEAILDVVEGRAAGSLYTRYGLNPTIQSLE 70 Query: 80 ERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQ 139 ++A+LEGAE A A SGM+A AL ++ G V+ +G T+ L FGI Sbjct: 71 AKLASLEGAEAAFAFCSGMAAETALFLAYGREG--VVCIGDAYGGTLELLADQLPLFGID 128 Query: 140 VDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCT 199 S+L E +L F+E+P+NP E+ D+AA+AE AHA GALLAVDN F + Sbjct: 129 THLILGSELDRLEDLLAGGARLVFLETPTNPALEVFDLAAIAEKAHAHGALLAVDNTFAS 188 Query: 200 PALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVGFLRTAGPTLSPFNAW 259 P QQPL LGAD +HSATKY+ G G + G E + + G+ + G +P Sbjct: 189 PVNQQPLALGADFAVHSATKYLGGHSDLTAGALMGSQELLAPIFGWRKNLGSMPAPETCN 248 Query: 260 LFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGAV 319 L + L TL +R++ +ASA A+AE ++R P + RV Y GLP P H+LA +Q SGFG + Sbjct: 249 LLARSLRTLVVRVRQQNASAQAVAEAMQRHPRVRRVLYPGLPDFPGHDLAAKQMSGFGGM 308 Query: 320 VSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSL 379 ++ +V + +D ++ +I +LG ++ + P TT+H LS +R R GI ++ Sbjct: 309 LTIEVDADTEGTAAVVDRLKLFAIAPSLGGAESLVTQPVTTTHHGLSETERERRGINGAM 368 Query: 380 IRVAVGLEDLDDLKADMARGLA 401 +R++VGLED +DL AD+ + L+ Sbjct: 369 VRLSVGLEDAEDLIADLEQALS 390 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 394 Length adjustment: 31 Effective length of query: 372 Effective length of database: 363 Effective search space: 135036 Effective search space used: 135036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory