Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate WP_092348401.1 BLU87_RS11360 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= SwissProt::P06106 (444 letters) >NCBI__GCF_900107645.1:WP_092348401.1 Length = 427 Score = 443 bits (1140), Expect = e-129 Identities = 224/428 (52%), Positives = 301/428 (70%), Gaps = 15/428 (3%) Query: 7 TVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTSNV 66 T+ LHAGQ D SRAVPIY T+SY F++++H + LF L+ G +Y+R NPT++V Sbjct: 11 TLALHAGQVP--DPTTNSRAVPIYQTSSYTFDSAEHAANLFSLKEMGNIYTRLMNPTTDV 68 Query: 67 LEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFG 126 LE+R+A L+GG ALA++SG AA TLAI +A GDNI+++S LYGGT+N F +FKR G Sbjct: 69 LEKRLAELDGGVGALALASGSAAVTLAIMNIAQCGDNIITSSCLYGGTFNLFHHTFKRMG 128 Query: 127 IEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTF 186 I +FV+ NP D+ TKA+Y ETIGNPK NV DFE + +AH +GIP +VDNT Sbjct: 129 IGVKFVDTSNPANVAAAIDDNTKALYTETIGNPKNNVDDFEALAKVAHDNGIPFIVDNTV 188 Query: 187 GAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEG 246 F +PI++GADIV +S TK+IGGHGT+IGG +VDSG F W +F +F+ P Sbjct: 189 ATPLLF-KPIEHGADIVCYSLTKFIGGHGTSIGGAVVDSGNFDWTS--GRFTEFTTPDPS 245 Query: 247 YHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKL 306 YHG +Y+EA GNLAYI+ +R LLRD+GP ++P +F LQG+ETL +R RH ENALK+ Sbjct: 246 YHGLVYHEALGNLAYILKMRLTLLRDMGPCLSPTNAFNFLQGLETLHVRMPRHCENALKV 305 Query: 307 AKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSG 366 A++LEQ P V+W++YPGL SH ++N ++YL G G ++ FG+K S Sbjct: 306 AQFLEQHPQVTWINYPGLESHKDYQNGQRYLPKGQGAIIGFGIKGGAE----------SS 355 Query: 367 AQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDD 426 A+ +D +KLAS+LAN+GDAKTLV+ P TTH+QLN +E+L +GVT D IR+SVGIE I+D Sbjct: 356 AKFIDKVKLASHLANIGDAKTLVVHPASTTHQQLNAEEQLTAGVTPDYIRISVGIEDIED 415 Query: 427 IIADFQQS 434 IIAD Q+ Sbjct: 416 IIADLDQA 423 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 427 Length adjustment: 32 Effective length of query: 412 Effective length of database: 395 Effective search space: 162740 Effective search space used: 162740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory