GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvH in Desulfuromonas acetexigens DSM 1397

Align Acetolactate synthase small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase small subunit; AHAS; ALS (uncharacterized)
to candidate WP_092052742.1 BQ4888_RS01530 ACT domain-containing protein

Query= curated2:Q89AP8
         (159 letters)



>NCBI__GCF_900111775.1:WP_092052742.1
          Length = 143

 Score = 40.8 bits (94), Expect = 9e-09
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 1  MKHRILSILLENESGALSRVVGLFSQRGYNIESITVAPTEDLSISKITI-QTFGDKKVIE 59
          MK   +SI +EN+SG L+ V  +  + G NI ++++A T D  I ++ + +T   K V++
Sbjct: 1  MKVEQISIFIENKSGRLAEVTRVLGEAGVNIRALSLADTSDFGILRLIVNKTDEAKAVLK 60

Query: 60 QIGKQLHKLIDVLKVTEIED 79
            G  ++K  DV+ V E+ D
Sbjct: 61 SKGFTVNK-TDVVAV-EVPD 78


Lambda     K      H
   0.317    0.136    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 50
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 159
Length of database: 143
Length adjustment: 16
Effective length of query: 143
Effective length of database: 127
Effective search space:    18161
Effective search space used:    18161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory