Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_276609542.1 BQ4888_RS07655 homoserine O-acetyltransferase
Query= SwissProt::B3E278 (367 letters) >NCBI__GCF_900111775.1:WP_276609542.1 Length = 366 Score = 504 bits (1299), Expect = e-147 Identities = 244/365 (66%), Positives = 287/365 (78%), Gaps = 2/365 (0%) Query: 3 IGVVHEQTITFEAGIRLESGRILAPITLVYELYGTMNADCSNVIMVEHAWTGDAHLAGKR 62 +G+V Q F+ +RLESGR+L P+TL YE YG +NAD SNVI+V HAWTGDAH AGK Sbjct: 1 MGIVTTQFAEFDVELRLESGRLLGPLTLAYETYGELNADRSNVILVAHAWTGDAHAAGKN 60 Query: 63 REDDPKPGWWDAIVGPGRLLDTDRYCVLCSNVIGSCYGSTGPASINPRTGKRYNLSFPVI 122 DD KPGWWD ++GPG++LDTDRY VLCSNVIGSC GSTGP S NPRTGK YNL+FPV+ Sbjct: 61 TPDDRKPGWWDDMIGPGKVLDTDRYFVLCSNVIGSCKGSTGPTSTNPRTGKPYNLTFPVL 120 Query: 123 TVRDMVRAQELLLDHLGIRRLLCVMGGSMGGMQALEWATQYPERVASVVALATTPRPSPQ 182 VRDMVRAQ+LLLD LGI LL V+GGSMG MQALEW+ YPE V S++ +A T R SP Sbjct: 121 MVRDMVRAQKLLLDRLGIDSLLTVIGGSMGAMQALEWSILYPEMVRSIIPIAGTGRTSPM 180 Query: 183 AISLNAVARWAIYNDPTWKKGEYK--HNPKDGLALARGIGHITFLSDESMWQKFERRFSA 240 AI+LNA+AR AI+NDP WKKG YK H P DGLAL R +GHI+FLSD SM KF RRFSA Sbjct: 181 AIALNALARQAIFNDPLWKKGNYKPEHPPADGLALGRAVGHISFLSDVSMQLKFGRRFSA 240 Query: 241 KDGLFDFFGQFEVERYLNYNGYNFVDRFDANCFLYLAKALDLYDVAWGYESMTDAFSRIT 300 + G FDFFGQFE+ERYL+YNG +FVDRFD N FLYLAKALDLYDVAW +ES+ +A ++ Sbjct: 241 RHGQFDFFGQFEIERYLDYNGASFVDRFDTNAFLYLAKALDLYDVAWNFESLEEALDQLR 300 Query: 301 APIQFFAFSSDWLYPPYQTEEMVTCLQGLGKEVEYHLIQSAYGHDAFLLEHETFTPMVRS 360 P +FAF+SDWLY P QTEE+VT L+ LGK V YHLI+S YGHD+FL+E E FTP V Sbjct: 301 CPSLWFAFTSDWLYTPSQTEEVVTVLRKLGKPVAYHLIESDYGHDSFLVEPEKFTPKVVE 360 Query: 361 LLERV 365 L+R+ Sbjct: 361 FLQRL 365 Lambda K H 0.323 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 366 Length adjustment: 30 Effective length of query: 337 Effective length of database: 336 Effective search space: 113232 Effective search space used: 113232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_276609542.1 BQ4888_RS07655 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.3872517.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-131 425.0 0.0 1.3e-131 424.8 0.0 1.0 1 NCBI__GCF_900111775.1:WP_276609542.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900111775.1:WP_276609542.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 424.8 0.0 1.3e-131 1.3e-131 4 350 .. 14 362 .. 11 363 .. 0.97 Alignments for each domain: == domain 1 score: 424.8 bits; conditional E-value: 1.3e-131 TIGR01392 4 eltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgraldtsryf 74 el lesG l +++ay+tyG+lna+r+N++lv Ha tg+ah+agk+ +d+ GWWd+++Gpg+ ldt+ryf NCBI__GCF_900111775.1:WP_276609542.1 14 ELRLESGRLLGPLTLAYETYGELNADRSNVILVAHAWTGDAHAAGKNTPDDRkpGWWDDMIGPGKVLDTDRYF 86 799*****************************************9988777678******************* PP TIGR01392 75 vvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmqalewal 147 v+c+Nv+GsckGstgP+s+np+tgkpy fP++ +rD+v+aqk lld+Lg+++l +v+GgS+G mqalew++ NCBI__GCF_900111775.1:WP_276609542.1 87 VLCSNVIGSCKGSTGPTSTNPRTGKPYNLTFPVLMVRDMVRAQKLLLDRLGIDSLLTVIGGSMGAMQALEWSI 159 ************************************************************************* PP TIGR01392 148 sypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARmlalltYrseeslee 220 ype+v++i+++a + r+s++aia+n+++rqai +Dp +++G+y+ e+ P+ GLal R +++++++s+ s++ NCBI__GCF_900111775.1:WP_276609542.1 160 LYPEMVRSIIPIAGTGRTSPMAIALNALARQAIFNDPLWKKGNYKPEHPPADGLALGRAVGHISFLSDVSMQL 232 ************************************************************************* PP TIGR01392 221 rfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlargrrdslkealkkikapv 293 +fgr+ ++++ ++ + +f++e yl+y+g +fv+rFd n++l+l+kald +d+a + +sl+eal+++++p+ NCBI__GCF_900111775.1:WP_276609542.1 233 KFGRRFSARH-GQFDFFGQFEIERYLDYNGASFVDRFDTNAFLYLAKALDLYDVAWN-FESLEEALDQLRCPS 303 ***9999885.578899***************************************9.8************** PP TIGR01392 294 lvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekveelirefl 350 l +++sD+l+t++++ee+++ l++ ++ y+ ies++GHD+Fl+e ek++ + efl NCBI__GCF_900111775.1:WP_276609542.1 304 LWFAFTSDWLYTPSQTEEVVTVLRKLGKPvaYHLIESDYGHDSFLVEPEKFTPKVVEFL 362 **************************99999************************9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.57 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory