Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_092056128.1 BQ4888_RS07925 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_900111775.1:WP_092056128.1 Length = 266 Score = 171 bits (434), Expect = 2e-47 Identities = 111/259 (42%), Positives = 144/259 (55%), Gaps = 9/259 (3%) Query: 5 VLAKIVADKAIWVEARKQQQPLASFQNE---VQPSTRHFYDAL----QGARTAFILECKK 57 +L KIVA K V K + P+ + V+ R F AL + TA I E KK Sbjct: 7 ILKKIVAHKREEVATAKAKFPMERLRQRLELVEDQPRGFVRALRIMHEAGGTAVIAEVKK 66 Query: 58 ASPSKGVIRDDFDPARIAAIYK-HYASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKD 116 SPSKGVIR DFDP IA Y+ H A+ +SVLTDEK+F G +L ++ + P+L KD Sbjct: 67 GSPSKGVIRPDFDPITIAETYQAHGATCLSVLTDEKFFLGHLQYLGLIREQVSLPLLRKD 126 Query: 117 FIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIA 176 FI DPYQI AR + ADA LL+ ++LD Q R A A L + VL EV +E E E A+ Sbjct: 127 FICDPYQIVEARAFGADAVLLIAAMLDLSQLRDFIACARELRLDVLLEVHDEAELELALQ 186 Query: 177 LGAKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQV-RELSHFANGFL 235 +++GINNR LR DL T L P + V++ESGIN A V R L A FL Sbjct: 187 TDCELIGINNRSLRTFVTDLGVTERLRPLVPAERLVVAESGINGRADVKRLLKAGAGAFL 246 Query: 236 IGSALMAHDDLHAAVRRVL 254 +G ALM D+ A + ++ Sbjct: 247 VGEALMREADIGAKLEELI 265 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 266 Length adjustment: 29 Effective length of query: 424 Effective length of database: 237 Effective search space: 100488 Effective search space used: 100488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory