Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_093427940.1 BM272_RS06415 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_900112605.1:WP_093427940.1 Length = 437 Score = 240 bits (613), Expect = 1e-67 Identities = 152/432 (35%), Positives = 229/432 (53%), Gaps = 17/432 (3%) Query: 365 SDKVGVQKALSRPIQ----KTSEIMHLVNPIIENVRDKGNSALLEYTEKFD---GVKLSN 417 +D+ G AL R + + +V I+ +VR +G++A++E T + D +++ Sbjct: 9 TDEDGFDAALDRLLAWEEGTDDRVEGIVRDILTDVRTRGDTAVVEQTNRLDRRDAATMAD 68 Query: 418 PVLNAPFPEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPI 477 L A + E L ++AL+ + E +R +H Q E+ + G + + P+ Sbjct: 69 LELPAERLQRALEALPSAQRQALETAAERIRGYHRHQCQ-ESWQYTEADGTVLGQQVTPM 127 Query: 478 EKVGLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGAS 537 ++ GLY+PGG A PS+ LM +PA+VA E+V P DG+++ V+ A G Sbjct: 128 DRAGLYVPGGKAAYPSSVLMNALPAKVAGVGELVMVVPA--PDGELNDLVLAAAAVAGVD 185 Query: 538 KIVLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSE 597 ++ GGAQAVAA+AYGTET+P VDKI+GPGN FV AK V IDM AGPSE Sbjct: 186 RVFTLGGAQAVAALAYGTETVPAVDKIVGPGNIFVATAKRMVFGTV----GIDMIAGPSE 241 Query: 598 VLVIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVD 657 +LV+ D + D ++VA DL SQAEH D+Q ILV + + + + +A+ + R Sbjct: 242 ILVVCDGETDPEWVAVDLFSQAEHDEDAQAILVCPDAAY--LDRVAEAMDRLLPTMGRET 299 Query: 658 IVRKCIA-HSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTP 716 I+R +A ++ C ++A + N+ APEHL L +A V +AG++F+G YT Sbjct: 300 IIRSSLAARGALIQCRDLDDAAAVINRVAPEHLELSVAEPEALAAKVRHAGAIFLGRYTS 359 Query: 717 ESCGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEG 776 ES GDY +G NH LPT AR S FQK + + G +G +A EG Sbjct: 360 ESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIGCSAAGAAALGPTAAALADGEG 419 Query: 777 LDGHRNAVKIRM 788 L H A + R+ Sbjct: 420 LGAHAEAARRRL 431 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 712 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 437 Length adjustment: 37 Effective length of query: 762 Effective length of database: 400 Effective search space: 304800 Effective search space used: 304800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory