Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_093427870.1 BM272_RS06005 inositol monophosphatase family protein
Query= curated2:P56160 (259 letters) >NCBI__GCF_900112605.1:WP_093427870.1 Length = 266 Score = 107 bits (267), Expect = 3e-28 Identities = 78/250 (31%), Positives = 120/250 (48%), Gaps = 14/250 (5%) Query: 1 MTPDLQLALELAEKAGKLTLDYFGRRS-LQVFSKRDDTPVTEADRNAEELIRQGISAKFP 59 M P L +A+ A +AGK G L + +K + V+E D AE+ I I +P Sbjct: 1 MDPMLNIAVRAARRAGKTITRAMGNVDRLNIETKAHNDFVSEVDYAAEQAIIDTIRDAYP 60 Query: 60 DDGLFGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPAL 119 G EE H WIIDP+DGT +F+HG P + V IAL +G + V+ P Sbjct: 61 SHGFIAEESGLHDQERDSVWIIDPLDGTTNFLHGFPQFAVSIALRHKGKLTQAVVYDPTR 120 Query: 120 GELYQAERGSGAFMNGSPVQVSAI--AENSASTVVFTEKE------YLLDPPSNHPVDQL 171 E++ A RG GA ++G ++VS E + F KE YL + HPV Sbjct: 121 EEMFTASRGGGAQLDGRRIRVSGRRGLEGALLGTGFPFKEPEHLDSYLAMFRAFHPV--- 177 Query: 172 RIDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSI 231 AG+ R +A+GR + + ++ WD AA + ++ EAGG D+ G ++ Sbjct: 178 --VAGIRRPGSAALDLAWLAAGRIDGFWEIGLNAWDIAAGVLLIREAGGLVGDFEGGEAY 235 Query: 232 IDGEGLVSAN 241 ++ LV+++ Sbjct: 236 METGNLVASS 245 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 266 Length adjustment: 25 Effective length of query: 234 Effective length of database: 241 Effective search space: 56394 Effective search space used: 56394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory