Align histidinol-phosphatase (EC 3.1.3.15) (characterized)
to candidate WP_093427934.1 BM272_RS06385 inositol monophosphatase
Query= BRENDA::Q8NS80 (260 letters) >NCBI__GCF_900112605.1:WP_093427934.1 Length = 275 Score = 85.1 bits (209), Expect = 1e-21 Identities = 72/242 (29%), Positives = 114/242 (47%), Gaps = 27/242 (11%) Query: 6 DDLALALELAELADSITLDRFEASDLEVSSKPDMTPVSDADLATEEALREKIATARPADS 65 D A+A + A++ L R+E E K D + V++AD A +EAL ++A PA Sbjct: 8 DLAAVAACVRRAAEAELLPRYERVGHEF--KADGSLVTEADTACQEALTAELARLAPAIP 65 Query: 66 ILGEEFGGDVE---FSGRQ---WIIDPIDGTKNYVRGVPVWATLIALLDNGKPVAGVISA 119 +LGEE + +G + WI+DP+DGT N+ G+P ++ +AL+ G+ V+ Sbjct: 66 LLGEEMTAAEQADYLTGNEAGLWILDPLDGTGNFAVGIPFFSISLALVVAGRVELAVVYH 125 Query: 120 PALARRWWASEGAGAW----RTFNGSSPRKLSVSQVSKLDDASLSFSSLSGWAERDLRDQ 175 P + A+ G GAW R G P ++ S L D + L+ Sbjct: 126 PTTGECFTAARGEGAWLDGERLGEGFQP---DLAHASALVDFKRLPTGLAA--------- 173 Query: 176 FVSLTDTTWR-LRGYGDF-FSYCLVAEGAVDIAAEPEVSLWDLAPLSILVTEAGGKFTSL 233 T+ +R R +G +C VA G + +WDLA S++++EAGG +L Sbjct: 174 -ALATEPPYRSQRSFGSVALDWCWVAAGRCHLYVHGGQKVWDLAAGSLILSEAGGHAATL 232 Query: 234 AG 235 AG Sbjct: 233 AG 234 Lambda K H 0.315 0.133 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 275 Length adjustment: 25 Effective length of query: 235 Effective length of database: 250 Effective search space: 58750 Effective search space used: 58750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory