Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate WP_093427733.1 BM272_RS05395 ketol-acid reductoisomerase
Query= metacyc::MONOMER-18814 (338 letters) >NCBI__GCF_900112605.1:WP_093427733.1 Length = 338 Score = 489 bits (1258), Expect = e-143 Identities = 238/338 (70%), Positives = 282/338 (83%) Query: 1 MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGVNVTVGLRKSGASWNKAANAG 60 M +FYDKDADLSLI+ + V I+GYGSQGHAHA NLK+SGV+V VGLR AS KA AG Sbjct: 1 MNIFYDKDADLSLIQKRKVAILGYGSQGHAHANNLKESGVDVVVGLRPGSASAAKAEQAG 60 Query: 61 LQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPRA 120 L V+ + +AV GAD+VM+L PDE +Y + N+++GAALAFAHGFN+HYG + PRA Sbjct: 61 LTVQSLDDAVAGADLVMVLAPDEHQGALYAEHIEPNLRQGAALAFAHGFNIHYGQIEPRA 120 Query: 121 DLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGIIE 180 DLDVIMIAPK PGH VR+TYTQGGGVP LIAV Q+ SG ARDIAL+YA+ANGGGRAG+I+ Sbjct: 121 DLDVIMIAPKGPGHLVRSTYTQGGGVPSLIAVEQDSSGQARDIALAYASANGGGRAGVIQ 180 Query: 181 TNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE 240 T+FREETETDLFGEQAVLCGGT L+KAGFETLVEAGYAPEMAYFECLHELKLIVDL+YE Sbjct: 181 TSFREETETDLFGEQAVLCGGTSALVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYE 240 Query: 241 GGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAPT 300 GGIANM YSISN AEYG++ G RVV E TK++M++ LT+IQ GE+A+ ++ EN+A AP Sbjct: 241 GGIANMRYSISNTAEYGDFTRGSRVVDEYTKESMREILTEIQNGEFAREWIAENQANAPV 300 Query: 301 LISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338 L + RRL AEHQIE+VG +LR MMPWIA NK+VD+SKN Sbjct: 301 LKANRRLGAEHQIEQVGERLRGMMPWIASNKIVDRSKN 338 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 338 Length adjustment: 28 Effective length of query: 310 Effective length of database: 310 Effective search space: 96100 Effective search space used: 96100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_093427733.1 BM272_RS05395 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.882026.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-141 456.2 0.5 2.8e-141 456.0 0.5 1.0 1 NCBI__GCF_900112605.1:WP_093427733.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900112605.1:WP_093427733.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.0 0.5 2.8e-141 2.8e-141 1 312 [. 14 326 .. 14 328 .. 0.99 Alignments for each domain: == domain 1 score: 456.0 bits; conditional E-value: 2.8e-141 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDevqk 73 ++++kvai+GyGsqG+a+a nl++sg++v+vglr+++as +kAe+ G+ v ++++a++ adl+m+L pDe q NCBI__GCF_900112605.1:WP_093427733.1 14 IQKRKVAILGYGSQGHAHANNLKESGVDVVVGLRPGSASAAKAEQAGLTVQSLDDAVAGADLVMVLAPDEHQG 86 5789********************************************************************* PP TIGR00465 74 evyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAveqdvtge 146 + y ++i+p+l++g+al f+HGfni++ qi++++d+dv+++APKgpG+lvR++y +g GvpsliAveqd++g+ NCBI__GCF_900112605.1:WP_093427733.1 87 ALYAEHIEPNLRQGAALAFAHGFNIHYGQIEPRADLDVIMIAPKGPGHLVRSTYTQGGGVPSLIAVEQDSSGQ 159 ************************************************************************* PP TIGR00465 147 akeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpelAyfeivhelk 219 a++iAlayA a Gg+ragv++t+F+eE+e+DLfGEqavLcGg +al+ka+f+tLveaGy+pe+Ayfe++helk NCBI__GCF_900112605.1:WP_093427733.1 160 ARDIALAYASANGGGRAGVIQTSFREETETDLFGEQAVLCGGTSALVKAGFETLVEAGYAPEMAYFECLHELK 232 ************************************************************************* PP TIGR00465 220 livdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefakewalekeagkpafeear 291 livdl++e+G+++mr ++sntA++g+++++ ++++e +k++m++il eiqnGefa+ew+ e++a++p +++ r NCBI__GCF_900112605.1:WP_093427733.1 233 LIVDLMYEGGIANMRYSISNTAEYGDFTRGsRVVDEYTKESMREILTEIQNGEFAREWIAENQANAPVLKANR 305 ******************************9****************************************** PP TIGR00465 292 kkekeqeiekvGkelralvka 312 + e++ie+vG++lr ++++ NCBI__GCF_900112605.1:WP_093427733.1 306 RLGAEHQIEQVGERLRGMMPW 326 *******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 16.28 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory