Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_093427016.1 BM272_RS01690 alanine transaminase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_900112605.1:WP_093427016.1 Length = 397 Score = 166 bits (420), Expect = 1e-45 Identities = 118/385 (30%), Positives = 186/385 (48%), Gaps = 25/385 (6%) Query: 7 RVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKT-KYA 65 R++ + P VN + R +G D+V G PD TP H+ + A + T +Y+ Sbjct: 7 RIKRLPPYVFNIVNDLKAKARARGEDIVDFGMGNPDQPTPRHIVDKLVEAAQRNNTHRYS 66 Query: 66 PPAGIPELREALAEKFRRENGLSVTPE-ETIVTVGGKQALFNLFQAILDPGDEVIVLSPY 124 GIP LR A+++ + +++ PE E IVT+G K+ L +L ++L+ GD V+V +P Sbjct: 67 VSRGIPRLRRAISQWYADRYDVAIDPENEAIVTIGSKEGLAHLALSVLEQGDTVLVPNPA 126 Query: 125 WVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKE 184 + +P V AG + V +P+ F + ER + PR K L++N P NPT + Sbjct: 127 YPIHPYGVVIAGADIRHVPLVPDVDFFAELERAIKEAWPRPKMLILNFPGNPTTQCVDLD 186 Query: 185 VLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS-----PGRVAPEHTLTVNGAAKAFAMT 239 E + +A E+ ++V D Y + ++G PG A E + +K + M Sbjct: 187 FFEHVVAMAREYGIWVVHDIAYAEITFDGYEAPSILQVPG--AKEVAVEFYSLSKTYNMP 244 Query: 240 GWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRR 299 GWR+G+ CG +++ A+A + S T Q A + AL E + E R Y RR Sbjct: 245 GWRVGFMCGNDKLVAALARMKSYLDYGTFTPIQVAAIHAL---EGPQECKEEIRAMYERR 301 Query: 300 RDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVR-------AAERLLEAGVAVVPGT 352 RD L+ GL G + P +V +PI P+ R + + L +A VAV PG Sbjct: 302 RDHLVSGLRGAGWEVESPRATMFV---WAPI-PEAYRHLGSLEFSKKLLQDAKVAVSPGI 357 Query: 353 DFAAFG--HVRLSYATSEENLRKAL 375 F +G HVR S +E R+A+ Sbjct: 358 GFGEYGDDHVRFSLIENEHRTRQAV 382 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 397 Length adjustment: 31 Effective length of query: 354 Effective length of database: 366 Effective search space: 129564 Effective search space used: 129564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory