Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_093429006.1 BM272_RS11855 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_900112605.1:WP_093429006.1 Length = 306 Score = 179 bits (453), Expect = 9e-50 Identities = 109/303 (35%), Positives = 169/303 (55%), Gaps = 13/303 (4%) Query: 7 IAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKS 66 + +++ + VP+ DA V TH LHYG F G R D GT + FRL H DRL +S Sbjct: 9 VIWYDGELVPWRDATTHVLTHTLHYGMGVFEGERAYA--ADGGTAI-FRLADHTDRLFRS 65 Query: 67 AKFLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDFLVYG 124 A + + E I E V++N + S YIRP+ + G+ R NL+ ++ Sbjct: 66 AHIMGMPMPYDRETINEATRQAVRENGLE-SAYIRPMAFYGSEGMGLRATNLQVHVIIAA 124 Query: 125 LEMGDYLAADG----VSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 G YL +G + R SS R S + K + YI S LA EAV G+DEA+ Sbjct: 125 WGWGAYLGEEGMERGIRVRTSSHSRHHVNSSMCKAKANGNYINSMLALQEAVSCGYDEAL 184 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 L++++G V E +G N+F+VRNG + TP LEGITR++I+ +A + GIP ++ + + Sbjct: 185 LLDTEGFVAEGSGENLFVVRNGVLYTP-ELTAALEGITRETIVHLAEEAGIPVREKRMTR 243 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLRSVLTAVTENREPKYQDWV 298 E+ +ADE F +GTAA++TPV+ ++ T+G R PITE+L+++ + R + DW+ Sbjct: 244 DEVYVADEAFFTGTAAEVTPVRELDGRTIGAGRRGPITEQLQTMYFELVHGRREPHHDWL 303 Query: 299 FKI 301 ++ Sbjct: 304 DRV 306 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 306 Length adjustment: 27 Effective length of query: 278 Effective length of database: 279 Effective search space: 77562 Effective search space used: 77562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory