Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_093394626.1 BM091_RS07235 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_900114975.1:WP_093394626.1 Length = 438 Score = 252 bits (644), Expect = 3e-71 Identities = 159/411 (38%), Positives = 227/411 (55%), Gaps = 21/411 (5%) Query: 388 VNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPE-----EYFEGLTEEMKEALDL 442 V I+E VR KG+ A++EYT FD ++ E E G + + + Sbjct: 34 VKGILEEVRKKGDRAIVEYTRAFDCPDFEKAMIAVSDDEIEKAYEEISGFDRDFTDIIRR 93 Query: 443 SIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGT---AILPSTALMLG 499 + +NVR+FH AQ + GV + RP+E VG YIPGG L ST +M Sbjct: 94 AADNVREFHEAQKERSWF-MTRDDGVFLGQMVRPVESVGAYIPGGAEGATPLISTVIMTV 152 Query: 500 VPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIP 559 +PA+VA KEI ASPPRK DG + P ++ A++ GA +I G A AVAA A+GTET+ Sbjct: 153 IPARVAGVKEIAIASPPRK-DGTLHPGLLVTAKECGAQRIYRMGSAWAVAAFAWGTETVK 211 Query: 560 KVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQA 619 V+ I+GPGN +VT AK + + +D+ AGPSEVL+IADE A+ FVA+DLLSQA Sbjct: 212 PVNIIVGPGNIYVTTAKRLLMG----IVGVDIIAGPSEVLIIADETANPVFVAADLLSQA 267 Query: 620 EHGIDSQVILVGVN--LSEKKIQEIQDAVHNQALQLPRVDIVRKCIA-HSTIVLCDGYEE 676 EH + +L+ N L+E I+E++ Q LPR D+ + + + L + + Sbjct: 268 EHDTYASPVLITWNKELAEGVIEEVK----RQVRSLPRRDVALEALTNYGACFLVENEDV 323 Query: 677 ALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYA 736 A E++N+ APEHL L + D++ + NAG++F+G YTPE GDY +G NH LPT A Sbjct: 324 AAELANRIAPEHLELHVKTPWDWLGKITNAGALFIGHYTPEPLGDYFAGPNHVLPTSQTA 383 Query: 737 RQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIR 787 R S F + I+ + E AV +A+ EGL+ H ++ IR Sbjct: 384 RFASALGVQNFLRRISLLHYPEEAFFRDASAVERMARWEGLEAHARSISIR 434 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 679 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 438 Length adjustment: 37 Effective length of query: 762 Effective length of database: 401 Effective search space: 305562 Effective search space used: 305562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory