Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 (characterized)
to candidate WP_093393429.1 BM091_RS03260 3-isopropylmalate dehydrogenase
Query= SwissProt::P9WKK9 (336 letters) >NCBI__GCF_900114975.1:WP_093393429.1 Length = 355 Score = 325 bits (834), Expect = 8e-94 Identities = 182/346 (52%), Positives = 226/346 (65%), Gaps = 16/346 (4%) Query: 2 KLAIIAGDGIGPEVTAEAVKVLDAVVPG----VQKTSYDLGARRFHATGEVLPDSVVAEL 57 ++A I GDG GPEV EAVKVLDAV ++ YDLG R+ TGE+LP V+ EL Sbjct: 7 RIAKIPGDGTGPEVVREAVKVLDAVAEKEGFKIEWVEYDLGGERYLRTGEILPAGVIDEL 66 Query: 58 RNHDAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPARLYPGVASPLS--GNPGI 115 R DAILLGAIG P V GVLERGLLL LRF+LD ++NLRP L+PGV +P+ G I Sbjct: 67 RQMDAILLGAIGHPDVKPGVLERGLLLELRFQLDQYVNLRPVTLFPGVYTPVKDKGPEDI 126 Query: 116 DFVVVREGTEGPYTGNGGAIRVGTPNEVATEVSVNTAFGVRRVVADAFE--RARRRRKHL 173 DFVVVRE TEG Y G GG +R GTP+EVA + S+NT GV R + AFE R R ++K + Sbjct: 127 DFVVVRENTEGLYAGAGGILRKGTPHEVAVQESINTRMGVERCIRFAFEYCRKRNKKKKV 186 Query: 174 TLVHKTNVLTFAGGLWLRTVDEVGECYPDVEVAYQHVDAATIHMITDPGRFDVIVTDNLF 233 TL KTNVL +A LW RT EV YPD+E Y HVDA + M+ +P FDVIVTDN+F Sbjct: 187 TLCGKTNVLIYAFDLWERTFREVAREYPDIETDYAHVDAICMWMVKNPEWFDVIVTDNMF 246 Query: 234 GDIITDLAAAVCGGIGLAASGNIDATRANPSMFEPVHGSAPDIAGQGIADPTAAIMSVAL 293 GDIITDL A + GG+G+AA GNI+ SMFEP+ GSAP G+ + +P AAI + + Sbjct: 247 GDIITDLGAMIQGGMGIAAGGNINPN--GVSMFEPIGGSAPKYTGKNVINPLAAICAGQM 304 Query: 294 LLSHLGEHDAAARVDRAVEAHLAT------RGSERLATSDVGERIA 333 +L HLGE AA RV AV+ +A G + T +VG+ +A Sbjct: 305 MLEHLGEEKAAQRVLEAVKRAVARDIKDLGAGKMGMTTQEVGDLVA 350 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 355 Length adjustment: 29 Effective length of query: 307 Effective length of database: 326 Effective search space: 100082 Effective search space used: 100082 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory