Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_093393134.1 BM091_RS02160 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_900114975.1:WP_093393134.1 Length = 419 Score = 348 bits (893), Expect = e-100 Identities = 190/407 (46%), Positives = 270/407 (66%), Gaps = 8/407 (1%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 S++V K+GG ++++VE+++ VA K+ +RK+ G VVVLSA TD LI LA + NP Sbjct: 2 SLIVQKYGGTSVANVERIKAVARKVYQRKREGHDIVVVLSARAGETDRLISLAHEVSPNP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 DPRELD+LLSTGE ++AL +A++ G KAIS TG Q I+TD YG ARI INT II Sbjct: 62 DPRELDMLLSTGEQVTIALFCMAMKDLGQKAISLTGYQAGIMTDDHYGEARITSINTAII 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 YLK ++ VAGFQG +ITTLGRGGSD TA+ALA +L AD+CE+Y DV+GV+T Sbjct: 122 KEYLKDGYVVAVAGFQGYDPHHNITTLGRGGSDTTAVALAAALRADICEIYTDVEGVFTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLI- 577 DP I +AR + ++S+EEM+E++ GA+VL ARA EF K+ + +L+ ++ K+ GTL+ Sbjct: 182 DPNICSNARKLSKISYEEMLEMASLGAKVLHARAVEFGMKFNIPILVCSSFKDVPGTLVT 241 Query: 578 WEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMKS-- 635 E +E +V VT+ + ++ + DVPD PG+AARI + + G+N+DMIIQG Sbjct: 242 GEDQDMEKYVVSGVTYTKNVGRITVTDVPDVPGMAARIFGPVGEAGINVDMIIQGSSGIP 301 Query: 636 GEYNTVAFIVPESQLGKLDIDLLKTRSE---AKEIIIEKGLAKVSIVGVNLTSTPEISAT 692 G+ N ++F V +S K ++L++ + A E+ +AKVSIVGV + S ++ Sbjct: 302 GKAN-ISFTVSKSNYEKA-MELVREIARDIGAGEVHGNDRIAKVSIVGVGMKSHSGVAGK 359 Query: 693 LFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE 739 +F LA E INI MIS S +ISV+ID KY E AV+ +H FELD++ Sbjct: 360 MFSALAAENINIMMISTSEIKISVVIDEKYTELAVRVLHDTFELDKD 406 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 749 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 419 Length adjustment: 36 Effective length of query: 703 Effective length of database: 383 Effective search space: 269249 Effective search space used: 269249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory