Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_093393469.1 BM091_RS03430 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_900114975.1:WP_093393469.1 Length = 393 Score = 249 bits (635), Expect = 1e-70 Identities = 135/358 (37%), Positives = 212/358 (59%), Gaps = 7/358 (1%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIME 66 L LR+ ID +D+ ++ ++ R R + EV RVK +A+ + P+RE +LK ++ Sbjct: 13 LDDLRIEIDEVDKELVRWLARRMRLSYEVGRVK-----RAQGLPLFDPDREEAILKKLVT 67 Query: 67 LNKGPLDNEEMAR-LFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125 LN PL + R ++REI+++ +L+ P++VA+LGP T+S AAL FGH V P + Sbjct: 68 LNTEPLLTPPILRSIYREILAASRSLQYPVKVAFLGPLWTYSHIAALFVFGHDVEYNPCS 127 Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185 +++EVF V + VVPVENS EG++ T+D +D+ I E + + +HL G Sbjct: 128 SMEEVFESVARNRYDIAVVPVENSVEGSIGITMDLMYRYDLYIVRECYVAMEYHL-AGNV 186 Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAA 245 I +Y+H ++ +QCR+WL H +V V SS A AA+ + AA+ AA Sbjct: 187 EDLKEIREVYAHPRAFSQCRRWLAEHLSDVALVECSSTAQAAELCREVRGRAALCNLYAA 246 Query: 246 QLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHS 305 +GL+ +AE I D P + TRF+ + ++ P+GDDKTSII + + PGAL+ L P Sbjct: 247 HHFGLNVVAEHISDYPDSVTRFIALSREKTSPSGDDKTSIIFGVSHAPGALYRALEPCVR 306 Query: 306 NGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPKA 363 +G++LTRIE+RP+R +Y+FF+D GH DP ++ L ++ +K+LGSYP+A Sbjct: 307 HGVNLTRIESRPARVPLKSYLFFVDLEGHENDPSVRAALSEMEDALPFVKILGSYPRA 364 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 393 Length adjustment: 30 Effective length of query: 335 Effective length of database: 363 Effective search space: 121605 Effective search space used: 121605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory