Align cystathionine β-synthase (O-acetyl-L-serine) monomer (EC 4.2.1.22; EC 2.5.1.134; EC 2.5.1.47) (characterized)
to candidate WP_092486552.1 BM299_RS15715 cysteine synthase A
Query= metacyc::HP_RS00545-MONOMER (306 letters) >NCBI__GCF_900115975.1:WP_092486552.1 Length = 312 Score = 235 bits (599), Expect = 1e-66 Identities = 126/307 (41%), Positives = 185/307 (60%), Gaps = 4/307 (1%) Query: 1 MMIITTMQDAIGRTPVFKFTNKDYPIPLNSAIYAKLEHLNPGGSVKDRLGQYLIGEGFKT 60 M + ++ IG TP+++ K + L I AKLE NPGGS+KDR+ ++ + Sbjct: 1 MPVYDDLKQLIGNTPLYEL--KKFGTGLPGRILAKLEFFNPGGSIKDRIALAMLEAAEQN 58 Query: 61 GKITSKTTIIEPTAGNTGIALALVAIKHHLKTIFVVPEKFSTEKQQIMRALGALVINTPT 120 G + + +IEPT+GNTGI LA+V + I +PE S E++ ++R LGA V+ TP Sbjct: 59 GVLRPGSVVIEPTSGNTGIGLAMVCASRGYRCILTMPETMSVERRNLLRVLGAEVVLTPG 118 Query: 121 SEGISGAIKKSKELAESIPDSYLPLQFENPDNPAAYYHTLAPEIVQELGTNLTSFVAGIG 180 EG+ GAI++++ELA IP + +P QF NP NPAA+ A EI ++ + VAG+G Sbjct: 119 GEGMPGAIRRAEELALEIPGAVIPAQFANPANPAAHRAATAEEIWRDTAGQVDILVAGVG 178 Query: 181 SGGTFAGTARYLKERIPAIRLIGVEP-EGSILNGGEPGPHEIEGIGVEFIPPFFENLDID 239 +GGT G KER P +R++ VEP E +L+GG+PGPH+I+GIG F+P +D Sbjct: 179 TGGTVTGIGEVFKERKPGLRVVAVEPAESPVLSGGKPGPHKIQGIGAGFVPEVLNTNVLD 238 Query: 240 GFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALKEAQRLP-EGSQVLTIFPDVADR 298 ++ + + R+LA++ GLLVG SSGAA AAL+ A R G V+ IFPD +R Sbjct: 239 EIMRVTGVQAMTAARRLAREEGLLVGISSGAAAHAALELAGREENRGRTVVAIFPDTGER 298 Query: 299 YLSKGIY 305 YLS ++ Sbjct: 299 YLSTELF 305 Lambda K H 0.316 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 312 Length adjustment: 27 Effective length of query: 279 Effective length of database: 285 Effective search space: 79515 Effective search space used: 79515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory