Align D-3-phosphoglycerate dehydrogenase (characterized, see rationale)
to candidate WP_092484432.1 BM299_RS11865 hydroxyacid dehydrogenase
Query= uniprot:Q5JGC4 (304 letters) >NCBI__GCF_900115975.1:WP_092484432.1 Length = 314 Score = 244 bits (624), Expect = 1e-69 Identities = 135/307 (43%), Positives = 202/307 (65%), Gaps = 5/307 (1%) Query: 1 MKVLVAAPLHEKAIEVLKNAGFEVVYE-EYPDEDRLVELVKDVDAIIVRSKPKVTRKVIE 59 MK ++ ++ E+L G EV+Y+ E + L +++ D +A+IVR++ KV+R +++ Sbjct: 1 MKTVITELNWKQGNEILSEMG-EVIYDPELWRKKELPDIIHDAEALIVRNQTKVSRTLLD 59 Query: 60 AAPKLKVIGRAGVGLDNIDLKAAEERGIKVVNSPGASSRSVAELAIGLIFAVARKIAFAD 119 +APKL+VIGR GVGLDNIDL+A +++GI VV + A++ SV E ++ AR A Sbjct: 60 SAPKLRVIGRLGVGLDNIDLQATKDKGISVVYARNANAISVVEYVFAVMLTFARHPVEAT 119 Query: 120 RKMREGVWAKKQCMGIELEGKTIGVVGFGRIGYQVAKIANALGMKVLFYDPY--PNEERA 177 ++ G W +K G EL GKT+G++G G IG ++A A A GM +L YDP+ P E Sbjct: 120 TDVKRGNWNRKLFTGSELYGKTLGLIGIGEIGTRLAARAKAFGMHLLGYDPFLPPYEIAI 179 Query: 178 KEVGGKFADLETLLKESDVVTLHVPLVDATYHLINEERLKLMKPTAILINAARGAVVDTD 237 + G + A+LE +++ +D ++LHVPL AT HLIN++ L+L+K TA +IN+ARG V+D Sbjct: 180 ADFGVEQANLEGVIRRADFISLHVPLNKATRHLINKQTLELVKSTAYIINSARGGVIDEQ 239 Query: 238 ALVKALQEGWIAGAGLDVFEEEPLPADHPLTKLDNVVLTPHIGASTVEAQMRAGVEVAEK 297 AL +AL IAGA LDV E+EP P + PL KLDNV+LTPHI T EAQ++ V VA + Sbjct: 240 ALYEALSNKKIAGAALDVLEQEP-PTNSPLLKLDNVILTPHIAGLTEEAQVKTSVLVARE 298 Query: 298 IVEALKG 304 +++ +G Sbjct: 299 VIKVFQG 305 Lambda K H 0.317 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 314 Length adjustment: 27 Effective length of query: 277 Effective length of database: 287 Effective search space: 79499 Effective search space used: 79499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory