Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_073036684.1 BUB04_RS02665 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q8TQ40 (389 letters) >NCBI__GCF_900129305.1:WP_073036684.1 Length = 398 Score = 166 bits (421), Expect = 8e-46 Identities = 116/393 (29%), Positives = 193/393 (49%), Gaps = 17/393 (4%) Query: 7 SDRINALPPYLFAAIDEAKDEMIAKGVDVIDLGVGDPDLPTHPHIVEAMREAVCDPKTHQ 66 S R++ + P AI+ + A+G VI GVG+PD T HI E +AV +T + Sbjct: 4 SQRVSQVQPSATLAINAKAKALRAEGKQVISFGVGEPDFDTPHHIGEMAVQAVRRGQT-R 62 Query: 67 YPSYAGMPEFREAAAEWCKKYKGIELDPATEVLSLIGSKEAVAHIPLAFVNPGDVVLYTD 126 Y + G+PE ++A + + G++ P EVL G K ++ ++ A ++PGD V+ Sbjct: 63 YTAVQGIPELKDAILDTIRADYGLDYLPE-EVLVSCGGKHSLYNLFQAVLDPGDQVIIPA 121 Query: 127 PGYPVYKIGTLFAGGEPYSLPLKAENSFLPDLDSIPADILKRAKLFFFNYPNNPTSATAD 186 P + Y AG EP + SF D +S+ + R ++ N P+NPT Sbjct: 122 PYWVSYPDMVRLAGAEPVIVDCPESASFKLDPESLRRAVTARTRMLILNSPSNPTGVHYK 181 Query: 187 MKFFEKVVEFCKKN-DIIAVHDNAYSQMVYDGYDAPSFLAAEGAMDIGIELYSH-SKTYN 244 + + + E + ++I V D+ Y +M+Y+G + E + + + SKTY Sbjct: 182 PEELKALAEVLLDHPEVIIVSDDIYYRMLYNGAQWANIAMVEPRLKERTFIVNGVSKTYA 241 Query: 245 MTGWRLGFAVGSKALIKGLGKVKSNVDSGVFDAIQIAGIAALSSSQACVDDTNKIYEERR 304 MTGWR+G+ +G +IK GK++S S Q A +AAL SQ V D + + +RR Sbjct: 242 MTGWRIGYMLGDAEVIKAAGKIQSQSTSNPCSVAQWAAVAALRGSQESVQDMLEAFSQRR 301 Query: 305 NVLIEGLTAM-GLEVKPPKATFYVWAPVPTGF----------TSIEFAKLLLEEAGIVAT 353 + ++E L + G+ P+ FYV+ V + S++ A L+EEA + Sbjct: 302 DYVMERLGRLPGVTCPEPQGAFYVFPNVSAYYGKTVGSRSIGGSLDLADYLMEEAHLAVV 361 Query: 354 PGVGFGDAGEGYVRFALTKPVERIKEAVERMKK 386 PGV FG G+ +R + + +KE +R++K Sbjct: 362 PGVAFG--GDRCIRLSFALSMAELKEGFDRLEK 392 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 398 Length adjustment: 31 Effective length of query: 358 Effective length of database: 367 Effective search space: 131386 Effective search space used: 131386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory