Align Succinylornithine transaminase; SOAT; EC 2.6.1.81; Succinylornithine aminotransferase (uncharacterized)
to candidate WP_074201116.1 BUQ81_RS04050 glutamate-1-semialdehyde 2,1-aminomutase
Query= curated2:Q3Z295 (406 letters) >NCBI__GCF_900141795.1:WP_074201116.1 Length = 432 Score = 154 bits (388), Expect = 6e-42 Identities = 111/337 (32%), Positives = 153/337 (45%), Gaps = 29/337 (8%) Query: 27 RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRL 86 R +G+ +WD GK YID+ G LGHAHPE+ EA+ +QA K G E + + Sbjct: 38 RAKGAYVWDVDGKRYIDYVGSWGPAILGHAHPEVVEAVQKQAEK--GLSYGAPTELEVEM 95 Query: 87 AKKLIDAT-FADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFT 145 A + + D V NSG EA A++LAR + + IV F+ +HG + Sbjct: 96 ADLICELIPSVDMVRMVNSGTEATMTAIRLARG------ATGRDRIVKFEGGYHGHSDSL 149 Query: 146 VSAGGQPAYSQDFAPLPPDIRHA--------AYNDINSASALID---DATCAVIVEPIQG 194 + G A + P P + YND + D D +IVEP+ G Sbjct: 150 LVKAGSGALTHG-VPSSPGVPKCLAEQTLTLTYNDAEQVRNVFDEVGDEIACIIVEPVAG 208 Query: 195 EGGVVPASNAFLQGLRELCDRHNALLIFDEVQTG--VGRTGELYAYMHYGVTPDLLTTAK 252 +P FL+ LR++CD H A+LIFDEV TG VG TG A YG+TPDL T K Sbjct: 209 NMNCIPPVPGFLETLRQVCDAHGAILIFDEVMTGFRVGLTG---AQGRYGITPDLTTFGK 265 Query: 253 ALGGGFPVGALLTTEECASVMTVG---THGTTYGGNPLASAVAGKVLELINTPEMLNGVK 309 +GGG PVGAL E S + T GNPLA A L+ I+ P ++ Sbjct: 266 VIGGGMPVGALGGKREIMSQLAPTGPVYQAGTLSGNPLAMAAGLTTLKRISQPGFFEDLE 325 Query: 310 QRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNAD 346 + L + H G+ +G + G A+ Sbjct: 326 AKTQKLAMGLEQVAHEEGIALTTNQVGGMFGFFFTAE 362 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 432 Length adjustment: 32 Effective length of query: 374 Effective length of database: 400 Effective search space: 149600 Effective search space used: 149600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory