Align glutamyl-tRNAGlx synthetase (EC 6.1.1.17; EC 6.1.1.24) (characterized)
to candidate WP_234947344.1 BUQ81_RS04575 glutamate--tRNA ligase
Query= metacyc::MONOMER-13959 (483 letters) >NCBI__GCF_900141795.1:WP_234947344.1 Length = 464 Score = 337 bits (863), Expect = 7e-97 Identities = 188/478 (39%), Positives = 280/478 (58%), Gaps = 22/478 (4%) Query: 5 VRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQLNYLK 64 ++ R+APSPTG++H+GNARTALFN L +G F++R+EDTD +R+ + LK Sbjct: 1 MKTRFAPSPTGYIHMGNARTALFNALMGHKRGATFLLRIEDTDTERSDMQYVDALKEDLK 60 Query: 65 WLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKEREEQIA 124 WLG+DW E DV G GPY QS+R DIY+ YY++LL+ GLAY C+CT ELE R+ Q Sbjct: 61 WLGLDWQEGPDVEGPNGPYFQSQRGDIYEKYYQQLLDAGLAYPCFCTPTELEVMRKAQAQ 120 Query: 125 RGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESDGIGD 184 G+ PRY G+ LT E+ + AEG ++RF+VP+G+ + F D +KG F++D IGD Sbjct: 121 AGQPPRYDGRCSRLTPEQVAQKKAEGIPYTLRFKVPKGEEVVFMDAIKGRQRFKTDDIGD 180 Query: 185 FVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFGHMTL 244 F+I K DG + F+ AIDD LM +THV+RGEDH++NTP+QI++ +A G +P++ HM++ Sbjct: 181 FIIRKADGAAAFFFSNAIDDALMGVTHVIRGEDHLTNTPRQILLLEALGLPVPEYAHMSM 240 Query: 245 IVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWS-PVGEEELFTKEQFIEI 303 IV LSKR S + I Q +E G+LP+AL N++ LG + + L +Q + Sbjct: 241 IVGPDGSPLSKRHGS--RSIRQLREEGFLPQALTNYMARLGHTYKDADNTLMDLQQLADG 298 Query: 304 FDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQEWV 363 F++++ +PA +D ++L++ + V+ L + + P Q KV E + Sbjct: 299 FELSQCGTAPARYDENQLRFWQKEAVQALSDEAAAQWLAPFAQ--DKVPAEKWPAFAALM 356 Query: 364 RKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEELEE 423 R I+L E +++ + E L T+ L E P A L + + Sbjct: 357 RDNITLPDEAVAWAERLFEPVPLPQTE-----------LSVEVAPGFFEAGAEALAQGAD 405 Query: 424 FTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRLK 481 F + K TG KGK+LF P+R A+TGQ HGPELP EL+G+E A++R + Sbjct: 406 F------KQLTEALKATGAKGKQLFQPLRWALTGQLHGPELPVLFELMGREEALRRFR 457 Lambda K H 0.316 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 580 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 464 Length adjustment: 33 Effective length of query: 450 Effective length of database: 431 Effective search space: 193950 Effective search space used: 193950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory