Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_074200794.1 BUQ81_RS02440 branched-chain amino acid transaminase
Query= reanno::psRCH2:GFF445 (307 letters) >NCBI__GCF_900141795.1:WP_074200794.1 Length = 310 Score = 481 bits (1239), Expect = e-141 Identities = 237/306 (77%), Positives = 263/306 (85%) Query: 2 SMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYNTPDGTAIFRLQAHTDR 61 +MADRDG+IW+DGE+V WR+A HVLTHTLHYGMGVFEGVRAY + GTAIFRL+ HT R Sbjct: 4 TMADRDGLIWFDGEMVPWREAKVHVLTHTLHYGMGVFEGVRAYESELGTAIFRLEEHTQR 63 Query: 62 LFDSAHIMNMPMPYSKEEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHVI 121 L +SA IM MP+ Y+ EE+NEA RAAVREN L SAYIRPMVFYGSEGMGLRA LK HVI Sbjct: 64 LINSAKIMQMPLNYTAEELNEAQRAAVRENGLRSAYIRPMVFYGSEGMGLRADNLKAHVI 123 Query: 122 VAAWHWGAYMGDEALELGIKVRTSSFTRHHVNITMTRAKSNGAYINSMLALQEAISGGAD 181 VAAW WGAYMG+E L+ GIKV TSSFTRHHVNITMTRAK+NG YINSMLALQEAIS GAD Sbjct: 124 VAAWEWGAYMGEENLKRGIKVATSSFTRHHVNITMTRAKANGNYINSMLALQEAISHGAD 183 Query: 182 EALMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRGTVLTLAAEHGLKIVEKRI 241 EAL+LDPEGYVAEGSGEN F+IKDGVIYTPE+T+CL+GITR TV+ LA E G +IVEKRI Sbjct: 184 EALLLDPEGYVAEGSGENFFMIKDGVIYTPELTSCLDGITRKTVMQLAREMGYEIVEKRI 243 Query: 242 TRDEVYIADEAFFTGTAAEVTPIREVDGRAIGIGRRGPITEKLQKAYFDLVTGKTDAHAE 301 TRDEVYIADEAFFTGTAAEVTPIRE+DGR IG G RGPITEKLQ+ YFD+V G+ H Sbjct: 244 TRDEVYIADEAFFTGTAAEVTPIRELDGRVIGAGSRGPITEKLQQRYFDVVHGRAPEHRR 303 Query: 302 WRTLVK 307 W T V+ Sbjct: 304 WLTPVE 309 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 310 Length adjustment: 27 Effective length of query: 280 Effective length of database: 283 Effective search space: 79240 Effective search space used: 79240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_074200794.1 BUQ81_RS02440 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.1598988.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-144 466.9 0.2 1.4e-144 466.7 0.2 1.0 1 NCBI__GCF_900141795.1:WP_074200794.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900141795.1:WP_074200794.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 466.7 0.2 1.4e-144 1.4e-144 1 298 [] 13 308 .. 13 308 .. 0.99 Alignments for each domain: == domain 1 score: 466.7 bits; conditional E-value: 1.4e-144 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvev 73 w+dGe+v++++akvhvlth+lhYG+gvfeG+RaYe++ g+aifrl+eh++Rl +saki++++++y++eel+e+ NCBI__GCF_900141795.1:WP_074200794.1 13 WFDGEMVPWREAKVHVLTHTLHYGMGVFEGVRAYESELGTAIFRLEEHTQRLINSAKIMQMPLNYTAEELNEA 85 9************************************************************************ PP TIGR01122 74 tkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsi 146 ++ ++r+n+l+saYiRp+v++G+e++gl++ +lk +vi+aawewgay+gee l++Gikv +ssf+r++vn+ NCBI__GCF_900141795.1:WP_074200794.1 86 QRAAVRENGLRSAYIRPMVFYGSEGMGLRA-DNLKAHVIVAAWEWGAYMGEENLKRGIKVATSSFTRHHVNIT 157 ******************************.899*************************************** PP TIGR01122 147 ptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdavik 219 +t+aka+gnY+ns+la +ea+++G+dea+lLd eGyvaeGsGen+f++kdgv++tP++ +s+L+gitr +v++ NCBI__GCF_900141795.1:WP_074200794.1 158 MTRAKANGNYINSMLALQEAISHGADEALLLDPEGYVAEGSGENFFMIKDGVIYTPEL-TSCLDGITRKTVMQ 229 **********************************************************.78************ PP TIGR01122 220 lakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegktekke 292 la+e+g+e++e+ri+r+e+y+aDe+f+tGtaaevtPire+Dgr ig+g+rGp+t+klq+++fd+v+g+ +++ NCBI__GCF_900141795.1:WP_074200794.1 230 LAREMGYEIVEKRITRDEVYIADEAFFTGTAAEVTPIRELDGRVIGAGSRGPITEKLQQRYFDVVHGRAPEHR 302 ************************************************************************* PP TIGR01122 293 ewltyv 298 wlt+v NCBI__GCF_900141795.1:WP_074200794.1 303 RWLTPV 308 ***987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.00 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory