Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_074201116.1 BUQ81_RS04050 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_900141795.1:WP_074201116.1 Length = 432 Score = 169 bits (429), Expect = 1e-46 Identities = 111/294 (37%), Positives = 153/294 (52%), Gaps = 19/294 (6%) Query: 29 LLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPM 88 + I R +GA VWD +G YID VG +G A LGH +PEVVEAV++QAE + PT + Sbjct: 34 VFIDRAKGAYVWDVDGKRYIDYVGSWGPAILGHAHPEVVEAVQKQAE--KGLSYGAPTEL 91 Query: 89 RGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRT---- 144 E L L P ++ V VNSGTEA A++ AR TGR + V G+ G + Sbjct: 92 EVEM-ADLICELIPSVDMVRMVNSGTEATMTAIRLARGATGRDRIVKFEGGYHGHSDSLL 150 Query: 145 --MGSLSVTWEPKYREPFLP--LVEPVEFIPYNDVEALKRAVDE---ETAAVILEPVQGE 197 GS ++T P +P L E + YND E ++ DE E A +I+EPV G Sbjct: 151 VKAGSGALT-HGVPSSPGVPKCLAEQTLTLTYNDAEQVRNVFDEVGDEIACIIVEPVAGN 209 Query: 198 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALG 257 P P FL R++ GA+LI DE+ TG R G A +GI PD+ T K +G Sbjct: 210 MNCIPPVPGFLETLRQVCDAHGAILIFDEVMTGF-RVGLTGAQGRYGITPDLTTFGKVIG 268 Query: 258 GGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLERTRLWE 308 GG+P+G + E+ + G T GNPLAMAAG+ ++ + + +E Sbjct: 269 GGMPVGALGGKREIMSQLAPTGPVYQAGTLSGNPLAMAAGLTTLKRISQPGFFE 322 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 432 Length adjustment: 31 Effective length of query: 364 Effective length of database: 401 Effective search space: 145964 Effective search space used: 145964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory