Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_074201667.1 BUQ81_RS07000 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_900141795.1:WP_074201667.1 Length = 395 Score = 366 bits (940), Expect = e-106 Identities = 190/397 (47%), Positives = 258/397 (64%), Gaps = 5/397 (1%) Query: 12 FQPASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGE 71 + + R+S++ S L I A+AA ++R+G+ +I LGAGEPDFDTP H+K A AI G+ Sbjct: 3 YPQSKRVSAVQPSPTLVITAKAAELRRQGRDIISLGAGEPDFDTPAHIKAAGIRAIEEGK 62 Query: 72 TKYTALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIP 131 T+YTA+DG PELK+A+ +KF+R+N L + ++ V++G KQ L+N A L+PGDEVIIP Sbjct: 63 TRYTAVDGIPELKQAVVDKFKRDNQLDFTPAQVLVSSGGKQSLYNLFQALLNPGDEVIIP 122 Query: 132 TPYWTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAY 191 PYW SY D+V + E PV+++ GF++TA ++ A+T RTR ++LNSP+NPSGA Y Sbjct: 123 APYWVSYPDMVKLAEAVPVIVSAGIRQGFKVTAGQIADAMTERTRMLILNSPNNPSGAVY 182 Query: 192 SAADYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAY 251 +A + + VL RHP V ++ DDMYEHI+ D F + P L RT+ NGVSKAY Sbjct: 183 TARELEAIASVLRRHPQVLIVTDDMYEHIILDDVPFTNILNVAPDLYERTVVCNGVSKAY 242 Query: 252 AMTGWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRR 311 AMTGWRIGYA GP +I AM VQSQ+TS P SISQ A++ ALNGPQD + +F+ R Sbjct: 243 AMTGWRIGYAAGPEPIIAAMRKVQSQSTSNPCSISQYAALEALNGPQDCIDVMVAAFRER 302 Query: 312 RDLVVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVA 371 + V +N I G+ +GAFY+F GVL + D + + LLE+A VA Sbjct: 303 NEFVYERVNQIAGMKSLPAKGAFYSFIDVNGVL-----ASHGYADDIELASDLLENAEVA 357 Query: 372 VVPGSAFGLSPFFRISYATSEAELKEALERIAAACDR 408 VVPG+AFG RIS+ATS L+ AL RI +R Sbjct: 358 VVPGTAFGAPGHIRISFATSLDALRTALSRIERHLNR 394 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 395 Length adjustment: 31 Effective length of query: 379 Effective length of database: 364 Effective search space: 137956 Effective search space used: 137956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory