Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_074200794.1 BUQ81_RS02440 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_900141795.1:WP_074200794.1 Length = 310 Score = 300 bits (768), Expect = 3e-86 Identities = 145/299 (48%), Positives = 203/299 (67%), Gaps = 2/299 (0%) Query: 9 IWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIY 68 IWF+GEMV W +AKVHV++H LHYG VFEG+R Y+S G +FR EH QRL +SAKI Sbjct: 12 IWFDGEMVPWREAKVHVLTHTLHYGMGVFEGVRAYESELGTAIFRLEEHTQRLINSAKIM 71 Query: 69 RFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWG 128 + P++ + +EL EA R +R+N L SAYIRP++F G GMG+ VI+AA+ WG Sbjct: 72 QMPLNYTAEELNEAQRAAVRENGLRSAYIRPMVFYGSEGMGLRAD-NLKAHVIVAAWEWG 130 Query: 129 AYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDV 188 AY+G E L++GI SS+ R N T AKA GNY++S+L EA HG E + LD Sbjct: 131 AYMGEENLKRGIKVATSSFTRHHVNITMTRAKANGNYINSMLALQEAISHGADEALLLDP 190 Query: 189 NGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLY 248 GY++EG+GEN F +KDGV++TP T S L GITR +++LA+E+G E+ E+ ++R+ +Y Sbjct: 191 EGYVAEGSGENFFMIKDGVIYTPELT-SCLDGITRKTVMQLAREMGYEIVEKRITRDEVY 249 Query: 249 LADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQV 307 +ADE F +GTAAE+TP+R +DG +G G GP+T+++QQ +F + G + WL V Sbjct: 250 IADEAFFTGTAAEVTPIRELDGRVIGAGSRGPITEKLQQRYFDVVHGRAPEHRRWLTPV 308 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 310 Length adjustment: 27 Effective length of query: 282 Effective length of database: 283 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory