Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate WP_074201116.1 BUQ81_RS04050 glutamate-1-semialdehyde 2,1-aminomutase
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_900141795.1:WP_074201116.1 Length = 432 Score = 154 bits (389), Expect = 5e-42 Identities = 103/305 (33%), Positives = 157/305 (51%), Gaps = 26/305 (8%) Query: 14 IVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILSTSFSTPIKD 73 I + + YVWD++G+RY+D+ G A LGH +P ++E ++ Q E LS T ++ Sbjct: 36 IDRAKGAYVWDVDGKRYIDYVGSWGPAILGHAHPEVVEAVQKQAEKG--LSYGAPTELEV 93 Query: 74 EMLQALDKVKPDKMDNAMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHGRT------ 127 EM + ++ P +D ++NSGTEA A++ AR TGR +I+ F+ +HG + Sbjct: 94 EMADLICELIPS-VDMVRMVNSGTEATMTAIRLARGATGRDRIVKFEGGYHGHSDSLLVK 152 Query: 128 AGSLSVTWNKKYREPFEP-----LVGPVEFLTFNNIEDL----SKIDNETAAVIVEPIQG 178 AGS ++T + P P L LT+N+ E + ++ +E A +IVEP+ G Sbjct: 153 AGSGALT----HGVPSSPGVPKCLAEQTLTLTYNDAEQVRNVFDEVGDEIACIIVEPVAG 208 Query: 179 ESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVPDILTAGKAI 238 IP F++ L++ + G++LIFDE+ TGF R G A Y I PD+ T GK I Sbjct: 209 NMNCIPPVPGFLETLRQVCDAHGAILIFDEVMTGF-RVGLTGAQGRYGITPDLTTFGKVI 267 Query: 239 GGGFPVSVVFLPDHIANKLEEGD---HGSTYGGNPMAMAAVTAACKVIEKENVVEQANQK 295 GGG PV + I ++L T GNP+AMAA K I + E K Sbjct: 268 GGGMPVGALGGKREIMSQLAPTGPVYQAGTLSGNPLAMAAGLTTLKRISQPGFFEDLEAK 327 Query: 296 GQQFS 300 Q+ + Sbjct: 328 TQKLA 332 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 432 Length adjustment: 31 Effective length of query: 356 Effective length of database: 401 Effective search space: 142756 Effective search space used: 142756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory