Align Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate WP_072906149.1 BUB13_RS04920 class II fructose-1,6-bisphosphate aldolase
Query= SwissProt::A8B2U2 (323 letters) >NCBI__GCF_900142125.1:WP_072906149.1 Length = 326 Score = 265 bits (677), Expect = 1e-75 Identities = 147/313 (46%), Positives = 198/313 (63%), Gaps = 10/313 (3%) Query: 3 LCTLRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKYSDMIYL 62 L R++ +A Y + A+N NN+EQ+Q I+ A + SPVI+Q S+GA Y++ L Sbjct: 12 LVNSRELFKKAVDGGYAIPAYNFNNLEQLQAIITACAETNSPVIIQVSKGARNYANETML 71 Query: 63 KKLCEAAL----EKHPDIPICIHLDHGDTLESVKMAIDLGFSSVMIDASHHPFDENVRIT 118 + + A+ E +IPI +HLDHGD+ E K ID GFSSVMID SH P+DENV +T Sbjct: 72 RYMATGAVQMAREMGSNIPIVLHLDHGDSFEICKSCIDSGFSSVMIDGSHLPYDENVALT 131 Query: 119 KEVVAYAHARGVSVEAELGTLGGIEED-VQNTVQLTEPQDAKKFVELTGVDALAVAIGTS 177 K+VV YAH V+VE ELG L GIE+D V T+P + + FV+ TGVD+LA++IGTS Sbjct: 132 KKVVEYAHQFDVTVEGELGVLAGIEDDVVAEKSTYTQPDEVEDFVKKTGVDSLAISIGTS 191 Query: 178 HGAYKFK---SESDIRLAIDRVKTISD-LTGIPLVMHGSSSVPKDVKDMINKYGGKMPDA 233 HGAYKFK ES L D ++ + G P+V+HG+SSV D+IN+YGGKM A Sbjct: 192 HGAYKFKLKEGESVPPLRFDILEECEKRIPGFPIVLHGASSVVPAYVDLINQYGGKMDGA 251 Query: 234 VGVPIESIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHPEKFDPRDYLGPGRDAITEM 293 VGVP + + A VCKIN+DSD R+A+T +R+ P +FDPR YLG R + E+ Sbjct: 252 VGVPEDQLRKAAASAVCKINIDSDGRLAVTAKVREYLANDPGEFDPRKYLGAARKELIEL 311 Query: 294 LIPKIKA-FGSAG 305 + K +A GSAG Sbjct: 312 IKHKNEAVLGSAG 324 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 326 Length adjustment: 28 Effective length of query: 295 Effective length of database: 298 Effective search space: 87910 Effective search space used: 87910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_072906149.1 BUB13_RS04920 (class II fructose-1,6-bisphosphate aldolase)
to HMM TIGR01859 (fba: fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01859.hmm # target sequence database: /tmp/gapView.2837720.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01859 [M=282] Accession: TIGR01859 Description: fruc_bis_ald_: fructose-1,6-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-118 380.0 0.1 5.1e-118 379.8 0.1 1.0 1 NCBI__GCF_900142125.1:WP_072906149.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900142125.1:WP_072906149.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.8 0.1 5.1e-118 5.1e-118 1 281 [. 12 325 .. 12 326 .] 0.97 Alignments for each domain: == domain 1 score: 379.8 bits; conditional E-value: 5.1e-118 TIGR01859 1 lvkakellekakkekYavgafninnlellqaileaaeeeksPvivqvsegavkYlg...gikvvvalvkalie 70 lv+ +el++ka +++Ya++a+n+nnle+lqai++a+ e++sPvi+qvs+ga++Y++ ++ +++++v+ + e NCBI__GCF_900142125.1:WP_072906149.1 12 LVNSRELFKKAVDGGYAIPAYNFNNLEQLQAIITACAETNSPVIIQVSKGARNYANetmLRYMATGAVQMARE 84 79******************************************************87777899999999999 PP TIGR01859 71 klsivPvalhLDhGssyescikaikaGfssvmiDashlpleenlketkkvveiahakgvsveaelGklgGied 143 s++P++lhLDhG+s+e c ++i++GfssvmiD+shlp++en+++tkkvve+ah+ v+ve elG+l+Gied NCBI__GCF_900142125.1:WP_072906149.1 85 MGSNIPIVLHLDHGDSFEICKSCIDSGFSSVMIDGSHLPYDENVALTKKVVEYAHQFDVTVEGELGVLAGIED 157 9999********************************************************************* PP TIGR01859 144 dvvekeaeladideakklvketgvDaLaiaiGtshGkykge.......pkldferlkeikklln.lPlvlhGa 208 dvv+++++++++de++++vk+tgvD+Lai+iGtshG yk + p l+f+ l+e +k+++ +P+vlhGa NCBI__GCF_900142125.1:WP_072906149.1 158 DVVAEKSTYTQPDEVEDFVKKTGVDSLAISIGTSHGAYKFKlkegesvPPLRFDILEECEKRIPgFPIVLHGA 230 ************************************7776666899*****************99******** PP TIGR01859 209 s.....................GipeeqlkkaiklgiakvnidtdlrlaftaairkvleekkdeydpRkilap 260 s G+pe+ql+ka+ ++++k+nid+d rla+ta++r++l+++ e+dpRk+l+ NCBI__GCF_900142125.1:WP_072906149.1 231 SsvvpayvdlinqyggkmdgavGVPEDQLRKAAASAVCKINIDSDGRLAVTAKVREYLANDPGEFDPRKYLGA 303 ************************************************************************* PP TIGR01859 261 arealkevvkekik.vlgsagk 281 ar++l e++k+k++ vlgsagk NCBI__GCF_900142125.1:WP_072906149.1 304 ARKELIELIKHKNEaVLGSAGK 325 *************989***998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (282 nodes) Target sequences: 1 (326 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.02 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory