Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.103; EC 1.2.1.106 (uncharacterized)
to candidate WP_072905185.1 BUB13_RS02485 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:A0RWW0 (348 letters) >NCBI__GCF_900142125.1:WP_072905185.1 Length = 345 Score = 301 bits (770), Expect = 2e-86 Identities = 157/349 (44%), Positives = 223/349 (63%), Gaps = 7/349 (2%) Query: 1 MKVGVVGASGYVGGETLRLLVNHPDVEIAAVTSRQHVGEYLHRVQPSLRGFTDLTFSELD 60 ++V VVGASGY G E +RLLV HP++EI++VTSRQH G + +V PSL GF DL +D Sbjct: 2 LRVAVVGASGYTGVELIRLLVGHPEIEISSVTSRQHEGLLISQVFPSLAGFCDLICEPVD 61 Query: 61 YDRLSDSCDLVFTAVPHGTATDIVRALYDRDIKVIDLSADYRLHDPADYTKWYGWEHPHP 120 ++ DLVFTA+PH +A +++ + KV+DLSADYRL D A Y +WY EH P Sbjct: 62 IAAIAAKSDLVFTALPHKSAMEVIPGFLEAGCKVVDLSADYRLKDQAVYEQWY-QEHSSP 120 Query: 121 DYLSKSVFGIPELHREEIRSAKLVSCPGCMAVTSILALAPPVREGLVDTEHIVVDSKIGS 180 + L+++V+G+PEL R E+ A+LV+ PGC + L LAP ++ L+D +++DSK G+ Sbjct: 121 ELLAEAVYGLPELFRSELAGARLVANPGCYPTSVALGLAPLLKNDLIDPATLIIDSKSGT 180 Query: 181 SGAGAGA--GTAHAMRAGVIRPYKPAKHRHTGEIEQELSGIAGKKIRVSMSPHAVDVVRG 238 SGAG A G+ + + Y A HRHT EIEQ LS +AG + V+ +PH + + RG Sbjct: 181 SGAGRSAKQGSLYCEVNEGFKAYGVAAHRHTPEIEQTLSTLAGCDVAVNFTPHLLPINRG 240 Query: 239 ILCTNHVFLTREASEKDLWKMYRQAYGEERFVRLIRDKKGLYKFPDPKFLVGSNFCDIGF 298 IL T + L ++ + +DL +YRQ Y +E FVR+ + P+ ++ G+NFCD+G Sbjct: 241 ILSTMYATLRKDQTSEDLINLYRQTYADEHFVRVTPGG----ELPNVAYVRGTNFCDVGL 296 Query: 299 DLDEDNNRLVAISASDNLMKGAAGSAIQNMNIMAGLDEMSGLRYTPLTP 347 D+ R+V +SA DNL+KGAAG AIQNMN++ G E GL PL P Sbjct: 297 VSDQRTGRVVVVSAIDNLVKGAAGQAIQNMNLICGFTEQLGLGIVPLFP 345 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 345 Length adjustment: 29 Effective length of query: 319 Effective length of database: 316 Effective search space: 100804 Effective search space used: 100804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory