Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_072905185.1 BUB13_RS02485 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_900142125.1:WP_072905185.1 Length = 345 Score = 340 bits (872), Expect = 4e-98 Identities = 174/346 (50%), Positives = 227/346 (65%), Gaps = 2/346 (0%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEP 103 +++V +VG +GYTGVEL+R+L HPE+ +S +TSR G+ +++++P+L G DL Sbjct: 1 MLRVAVVGASGYTGVELIRLLVGHPEIEISSVTSRQHEGLLISQVFPSLAGFCDLICEPV 60 Query: 104 DVNVLGA-CDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHES 162 D+ + A DLVF A PH AM ++P + AG +VVDLSAD+RLKD V+ WY H S Sbjct: 61 DIAAIAAKSDLVFTALPHKSAMEVIPGFLEAGCKVVDLSADYRLKDQAVYEQWY-QEHSS 119 Query: 163 PEWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSG 222 PE +AVYGLPE+ R E+ A+LVANPGCYPT+V LG PLL+ L+DP LI D+KSG Sbjct: 120 PELLAEAVYGLPELFRSELAGARLVANPGCYPTSVALGLAPLLKNDLIDPATLIIDSKSG 179 Query: 223 ASGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIR 282 SGAGR K G L+ E+ E FKAYG + HRH PEI Q L AG DV V F PHL+P+ R Sbjct: 180 TSGAGRSAKQGSLYCEVNEGFKAYGVAAHRHTPEIEQTLSTLAGCDVAVNFTPHLLPINR 239 Query: 283 GIEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQ 342 GI +T+YA L+ + L L+ Q + DE FV V P G P VRG N C + L Sbjct: 240 GILSTMYATLRKDQTSEDLINLYRQTYADEHFVRVTPGGELPNVAYVRGTNFCDVGLVSD 299 Query: 343 EQSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 +++ V+V S IDNLVKGAAGQA+QNMN++ G E +GL L P Sbjct: 300 QRTGRVVVVSAIDNLVKGAAGQAIQNMNLICGFTEQLGLGIVPLFP 345 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 345 Length adjustment: 30 Effective length of query: 358 Effective length of database: 315 Effective search space: 112770 Effective search space used: 112770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_072905185.1 BUB13_RS02485 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.1314007.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-143 461.8 0.0 8.5e-143 461.6 0.0 1.0 1 NCBI__GCF_900142125.1:WP_072905185.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900142125.1:WP_072905185.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.6 0.0 8.5e-143 8.5e-143 2 345 .] 3 345 .] 2 345 .] 0.99 Alignments for each domain: == domain 1 score: 461.6 bits; conditional E-value: 8.5e-143 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadvvflA 74 +va+vGasGYtG+eL+rll Hpe+e+++++s++++g +s+v+p+l g+ dl +e++++++i+++ d+vf+A NCBI__GCF_900142125.1:WP_072905185.1 3 RVAVVGASGYTGVELIRLLVGHPEIEISSVTSRQHEGLLISQVFPSLAGFCDLICEPVDIAAIAAKSDLVFTA 75 8***************************7777777************************************** PP TIGR01850 75 lphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeikkaklianP 147 lph+ ++e++p +le+g+kv+dlSad+Rlkd++vYe+wY++ h+++ell+eavYGlpEl r+e+++a+l+anP NCBI__GCF_900142125.1:WP_072905185.1 76 LPHKSAMEVIPGFLEAGCKVVDLSADYRLKDQAVYEQWYQE-HSSPELLAEAVYGLPELFRSELAGARLVANP 147 ***************************************98.9999*************************** PP TIGR01850 148 GCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvtkHrHtpEieqelsk 220 GCy+T++ L+laPllk++li+p ++i+d+ksG+SgAGr+a++ sl++evne +k+Y v+ HrHtpEieq+ls+ NCBI__GCF_900142125.1:WP_072905185.1 148 GCYPTSVALGLAPLLKNDLIDPATLIIDSKSGTSGAGRSAKQGSLYCEVNEGFKAYGVAAHRHTPEIEQTLST 220 ************************************************************************* PP TIGR01850 221 laekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegelPstkavlgsnfvd 293 la+ +v v+ftphl+p+ rGil+t+ya+l+k+ t+e+l +ly+++Y+de+fvrv + gelP++ v+g+nf+d NCBI__GCF_900142125.1:WP_072905185.1 221 LAGCDVAVNFTPHLLPINRGILSTMYATLRKDQTSEDLINLYRQTYADEHFVRVTPGGELPNVAYVRGTNFCD 293 **99********************************************************************* PP TIGR01850 294 igvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +g+ d++t+rvvvvsaiDNLvKGaagqA+qn+Nl +gf+e+ gL +pl+p NCBI__GCF_900142125.1:WP_072905185.1 294 VGLVSDQRTGRVVVVSAIDNLVKGAAGQAIQNMNLICGFTEQLGLGIVPLFP 345 *************************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.41 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory