Align 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase; ADH synthase; ADHS; ADTH synthase; EC 2.2.1.10 (characterized)
to candidate WP_078715827.1 B5D49_RS01240 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
Query= SwissProt::Q6LZE3 (272 letters) >NCBI__GCF_900167125.1:WP_078715827.1 Length = 266 Score = 323 bits (828), Expect = 2e-93 Identities = 147/259 (56%), Positives = 202/259 (77%) Query: 9 NVGKLIRLERIFDKKSEKTVIIPMDHGVSSGPLDGIKDMRITTNAVADGGANAVLGHKGL 68 ++GK IRLERIF++ + +T+++PMDHGV+ GP++GI+DMR + V +GGANAVL HKG Sbjct: 2 HIGKAIRLERIFNRNTHRTIVVPMDHGVTVGPIEGIEDMREAVSRVVEGGANAVLEHKGN 61 Query: 69 VRHGHRGYGRDIGLIIHMSAGTSISPDPNKKVIVTTVEDAMRMGADAVSLHVNVGAESDF 128 VR GHR GRD+GLI+H+SA T +SP PN K +V +VEDA+ +GADAVS+H+N+G +++ Sbjct: 62 VRCGHRAEGRDVGLIVHLSASTCLSPRPNYKGLVASVEDAVCLGADAVSVHLNLGDDNET 121 Query: 129 EMYRDLGLISETCEHWGMPLIAMMYPRGPKIKDEKDPEVVAHAARLGAELGADIIKTNYT 188 +M RD+G ++ WGMPL+AM+Y RGPK+KDE DP VVAH AR+G ELGAD++K NYT Sbjct: 122 DMLRDVGRVATDAARWGMPLLAMVYARGPKVKDEYDPAVVAHCARVGTELGADVVKVNYT 181 Query: 189 GDPDTFKEVVKGCPAPIVIAGGPKTNTDEEFLQMVKDAMHAGGKGVASGRNVFQHKDVKG 248 GDPD+F V C P+VIAGGPK ++ EFLQMV+D++ AGG G++ GRNVFQH V Sbjct: 182 GDPDSFSRVTGACCIPVVIAGGPKMDSTGEFLQMVRDSLMAGGAGLSVGRNVFQHPRVTK 241 Query: 249 ITSAICKIVHEDVEVEEAL 267 + A+ +VHED++V+EA+ Sbjct: 242 LVQALSMVVHEDMQVDEAV 260 Lambda K H 0.317 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 266 Length adjustment: 25 Effective length of query: 247 Effective length of database: 241 Effective search space: 59527 Effective search space used: 59527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory