Align Probable fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Probable fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate WP_078717452.1 B5D49_RS09460 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
Query= curated2:Q9YG90 (272 letters) >NCBI__GCF_900167125.1:WP_078717452.1 Length = 265 Score = 158 bits (399), Expect = 1e-43 Identities = 95/268 (35%), Positives = 148/268 (55%), Gaps = 8/268 (2%) Query: 6 DVGKRVRLSRILPDG--RSVIFAFDHGIEHGPGEIPEERLDPRLLIREVVEAGVDAIMTT 63 + GK +RL RI R+++ DHG+ GP + E D R ++ +V G +A + Sbjct: 2 NTGKALRLDRIFNRNTRRTIVVPMDHGVTVGPIQGLE---DIREMVTRLVNGGANAGLVH 58 Query: 64 PGIARLTWDIWANRVAMIIKVSGKTSIRPQDDQFLQSAISSVDEVVALGGDGVAATVYWG 123 G +I+ +S TS+ P ++ ++ +++V+E + +G DGV+ V G Sbjct: 59 KGCVACGHRSEGRDFGLIVHLSASTSLSPFPNR--KALVTTVEEALRMGADGVSVHVNIG 116 Query: 124 SQFEDKMLERWTRIRLRAEKLGLPALQLAYPRGPHIKNRYAVDIVAYGARAAMETGADLI 183 + E MLE RA+ G+P L + Y RGP I+N Y ++VA+ AR ME GAD++ Sbjct: 117 DENESVMLEHLGSTAERADYWGIPLLAMVYARGPKIRNEYEPEVVAHCARVGMELGADIV 176 Query: 184 KTYYTGSTESFRRVVSAAGGVPVLMSGGARTPSPQEFLHKVYSVMEAGGGGVVVGRNIFQ 243 K YTGS ESF V + VPV+++GG + S Q+ L V + + AGG G+ VGRN+FQ Sbjct: 177 KVNYTGSVESFAHVTESC-CVPVVIAGGEKLDSTQDLLEMVKNSLMAGGAGLSVGRNVFQ 235 Query: 244 AGDIRAMVKAIRAIVHEGFDPEKASKLL 271 D +V+A+ IVHE ++A +LL Sbjct: 236 HDDPTGLVRALHHIVHENGSVDEAMRLL 263 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory