Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate BPHYT_RS11210 BPHYT_RS11210 ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__BFirm:BPHYT_RS11210 Length = 351 Score = 204 bits (519), Expect = 3e-57 Identities = 122/309 (39%), Positives = 180/309 (58%), Gaps = 17/309 (5%) Query: 42 SLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCA 101 +LL MI+ FS S +F+ D +I V+++ T+V+I +GIDLSVG+++ A Sbjct: 54 ALLGMIVLFSLLSSHFLTYDTFSTIANQIPDLVVMSVGMTFVLIIAGIDLSVGSVLALGA 113 Query: 102 VMAGVVLTNWGM-PLP---LGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKG 157 + V WG PLP LG+AAA AL+G I+G V ++P FI +LG++ +G Sbjct: 114 SVVSVAALKWGWGPLPSAVLGVAAA----ALTGTITGAVTVGWRIPSFIVSLGVLEAARG 169 Query: 158 LSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVF 217 ++ ++ +R Y D F ++ +G I A LI V + A ++L +TVF Sbjct: 170 MAYQMTNSRTAYIGDA--FDFLSNPIALG-------ISPAFLIAVAVMVIAQLVLTRTVF 220 Query: 218 GRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYEL 277 GRY +G+NEEA+RL+GV +KV V+ GA+ G+A L SRL +A P GQG EL Sbjct: 221 GRYLVGIGTNEEAVRLAGVNPRPYKVIVFALMGALSGLAALFQISRLEAADPNAGQGVEL 280 Query: 278 DAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVY 337 IAAVVIGGTSL GG G+++ T G I+SVL GL + + + ++TG +I++AV Sbjct: 281 QVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGANEPTKRMITGAVIVVAVV 340 Query: 338 LDILRRRRR 346 LD R RR+ Sbjct: 341 LDTYRSRRK 349 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 351 Length adjustment: 29 Effective length of query: 318 Effective length of database: 322 Effective search space: 102396 Effective search space used: 102396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory