GapMind for catabolism of small carbon sources

 

Protein 349964 in Bacteroides thetaiotaomicron VPI-5482

Annotation: FitnessBrowser__Btheta:349964

Length: 468 amino acids

Source: Btheta in FitnessBrowser

Candidate for 13 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arabinose catabolism araE med Arabinose-proton symporter; Arabinose transporter (characterized) 39% 96% 329.7 D-xylose-proton symporter 38% 315.5
D-galactose catabolism galP med Arabinose-proton symporter; Arabinose transporter (characterized) 39% 96% 329.7 D-xylose-proton symporter 38% 315.5
D-xylose catabolism xylT med Arabinose-proton symporter; Arabinose transporter (characterized) 39% 96% 329.7 Glucose/fructose:H+ symporter, GlcP 35% 297.7
D-cellobiose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
D-fructose catabolism glcP lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
D-glucose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
lactose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
D-maltose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
sucrose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
sucrose catabolism glcP lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
trehalose catabolism MFS-glucose lo Glucose/fructose:H+ symporter, GlcP (characterized) 35% 98% 297.7 Arabinose-proton symporter; Arabinose transporter 39% 329.7
myo-inositol catabolism iolT lo Major myo-inositol transporter, IolT1, of 456 aas (characterized) 35% 95% 292 Arabinose-proton symporter; Arabinose transporter 39% 329.7
myo-inositol catabolism HMIT lo Probable inositol transporter 2 (characterized) 36% 58% 211.5 Arabinose-proton symporter; Arabinose transporter 39% 329.7

Sequence Analysis Tools

View 349964 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKSTINFGYLIFLSVVAALGGFLFGYDTAVISGTIAQVTQLFQLDTLQQGWYVGCALIGS
IVGVLFAGILSDKLGRKMTMIISATLFSTSALGCAISADFTQLVVYRIIGGVGIGVVSIV
SPLYISEVAVAQYRGRLVSLYQLAVTVGFLGAYLINYQLLAYAESGNQLSMDWLNKIFVT
EVWRGMLGMETLPAVLFFIIIFFIPESPRWLIVRGKEEKAVNILERIYNSVSEAASQLKE
TKSVLTSETKSEWAMLMKPGIFKAVIIGVCIAILGQFMGVNAVLYYGPSIFENAGLSGGD
SLFYQVLVGLVNTLTTVLALVIIDRVGRKQLVYYGVSGMVVSLLLIGVYFLFGDSWGVSS
LFLLVFFLFYVFCCAVSICAVVFVLLSEMYPTKVRGLAMSIAGFALWIGTYLIGQLTPWM
LQNLTPAGTFFLFAVMCVPYMLIVWKLVPETTGKSLEEIERYWTRSEQ

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory