Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 353166 BT3640 lipoprotein releasing system ATP-binding protein (NCBI ptt file)
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Btheta:353166 Length = 218 Score = 95.9 bits (237), Expect = 6e-25 Identities = 58/212 (27%), Positives = 111/212 (52%), Gaps = 19/212 (8%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 ++ +G++KSFG L+ + D+ + +G I ++GP+GAGKTTL ++ PD G V Sbjct: 1 MIKLEGITKSFGSLQVLKGIDLEINKGEIVSIVGPSGAGKTTLLQIMGTLDEPDAGTVAI 60 Query: 78 NGDSIGQLAPHQIAL---RGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFR 134 +G + ++ +++ + FQ ++L T LEN++ +P I Sbjct: 61 DGTVVSRMKEKELSAFRNKNIGFVFQFHQLLPEFTALENVM-----------IPAFI--- 106 Query: 135 RVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPA 194 + E+AM +L +GL +A LSGG+++ + +ARAL+++P +IL DEP+ Sbjct: 107 -AGVSSKEANERAMEILAFMGLTDRASHKPNELSGGEKQRVAVARALINHPAVILADEPS 165 Query: 195 AGVNPTLIGQICEHIVNW-NRQGITFLVIEHN 225 ++ + + + +R G TF+++ H+ Sbjct: 166 GSLDTHNKEDLHQLFFDLRDRLGQTFVIVTHD 197 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 218 Length adjustment: 23 Effective length of query: 244 Effective length of database: 195 Effective search space: 47580 Effective search space used: 47580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory