Align Glucose/fructose:H+ symporter, GlcP (characterized)
to candidate 350322 BT0794 D-xylose-proton symporter (D-xylose transporter) (NCBI ptt file)
Query= TCDB::P15729 (468 letters) >FitnessBrowser__Btheta:350322 Length = 484 Score = 303 bits (775), Expect = 1e-86 Identities = 189/489 (38%), Positives = 272/489 (55%), Gaps = 60/489 (12%) Query: 16 FVLLISGVAALGGFLFGFDTAVINGAVAALQ------KHFQTDSLLTGLSVSLALLGSAL 69 ++ I+ VA LGG LFG+DTAVI+GA L+ FQ + ++ G++ S AL+G L Sbjct: 12 YLYSITSVAILGGLLFGYDTAVISGAEKGLEAFFLSASDFQYNKVMHGITSSSALIGCVL 71 Query: 70 GAFGAGPIADRHGRIKTMILAAVLFTLSSIGSGLPFTIW------------DFIFWRVLG 117 G +G A R GR ++ LAAVLF LS++GS P ++ F +RVLG Sbjct: 72 GGALSGVFASRLGRRNSLRLAAVLFFLSALGSYYPEVLFFEYGKPNMDLLIAFNLYRVLG 131 Query: 118 GIGVGAASVIAPAYIAEVSPAHLRGRLGSLQQLAIVSGIFIALLSNWFIALMAGGSAQNP 177 GIGVG AS + P YIAE++P+++RG L S Q AI+ G+ + N+ I G QNP Sbjct: 132 GIGVGLASAVCPMYIAEIAPSNIRGTLVSCNQFAIIFGMLVVYFVNYLIM----GDHQNP 187 Query: 178 WLFGAAA-----------------WRWMFWTELIPALLYGVCAFLIPESPRYLVAQGQGE 220 + AA WR+MF +E PA +G+ F +P++PRYLV Q E Sbjct: 188 IILKDAAGVLSVSAESDMWTVQEGWRYMFGSEAFPAAFFGLLLFFVPKTPRYLVLVQQEE 247 Query: 221 KAAAILWKVEGGDVPSRI-EEIQATVSLDHKPRFSDLLSRRGGLLPIVWIGMGLSALQQF 279 KA IL K+ G I +I+AT + F+ ++ ++ IG+ LS QQ Sbjct: 248 KAYTILEKINGKKKAQEILNDIKATAQEKTEKLFTYGVT-------VIVIGILLSVFQQA 300 Query: 280 VGINVIFYYSSVLWRSVGFTEEKSLLITVITGFINILTTLVAIAFVDKFGRKPLLLMGSI 339 +GIN + YY+ ++ + G E ++ TVI G +NI+ TLVAI VD+FGRKPLL++GSI Sbjct: 301 IGINAVLYYAPRIFENAG-AEGGGMMQTVIMGIVNIIFTLVAIFTVDRFGRKPLLIIGSI 359 Query: 340 GMTITLGILSVVFGGATVVNGQPTLTGAAGIIALVTANLYVFSFGFSWGPIVWVLLGEMF 399 GM + G +V + + G ++ +++ +Y F SWGPI WVL+ E+F Sbjct: 360 GMAV--GAFAVAMCDSMAIKG---------VLPVLSIIVYAAFFMMSWGPICWVLISEIF 408 Query: 400 NNKIRAAALSVAAGVQWIANFIISTTFPPLLDTVGLGPAYGLYATSAAISIFFIWFFVKE 459 N IR A+++A QWI N+I+S+TFP L D + AY LY + F+W +V E Sbjct: 409 PNTIRGKAVAIAVAFQWIFNYIVSSTFPALYDFSPMF-AYSLYGIICVAAAIFVWRWVPE 467 Query: 460 TKGKTLEQM 468 TKGKTLE M Sbjct: 468 TKGKTLEDM 476 Lambda K H 0.325 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 25 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 484 Length adjustment: 33 Effective length of query: 435 Effective length of database: 451 Effective search space: 196185 Effective search space used: 196185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory