Align Glucose/galactose transporter (characterized, see rationale)
to candidate 353142 BT3616 fucose permease (NCBI ptt file)
Query= uniprot:A0KXM0 (423 letters) >FitnessBrowser__Btheta:353142 Length = 418 Score = 241 bits (616), Expect = 2e-68 Identities = 148/414 (35%), Positives = 216/414 (52%), Gaps = 15/414 (3%) Query: 22 YRFALVSLTSLFFMWGFITCLNDILIPHLKAVFSLNYTQAMLIQFCFFGAYFLVSIPAGQ 81 Y L + SLFF+W + L +I L LN +A + ++ AYF+ IP Sbjct: 6 YTIPLALVFSLFFLWAISSNLLPTMIRQLMKTCELNTFEASFTETAYWLAYFIFPIPIAM 65 Query: 82 LVKRLGYQKGIVTGLVIASIGCGLFYPAASFATYGLFLGALFVLASGITILQVAANPYVN 141 +KR Y+ GI+ GL++A++G LF+PAA Y +L F++A+G+ L+ AANPYV Sbjct: 66 FMKRYSYKAGIIFGLLLAAVGGLLFFPAAMLKEYWAYLCIFFIIATGMCFLETAANPYVT 125 Query: 142 ALGSSETASSRLNLTQAFNALGTTVAPFFGSILILSVAASVSSEL---------AQANAE 192 LG+ ETA RLNL Q+FN LG +A F S LILS L A E Sbjct: 126 VLGAPETAPRRLNLAQSFNGLGAFIAAMFLSKLILSGTHYTRETLPVDYPGGWQAYIQLE 185 Query: 193 AEVVKLPYLLLAAALAVLAIIFAKLDLPVIREHSQAAAEEVQTHLGKTSALQSMHLVLGA 252 + +KLPYL+LA L +A++F LP I + A + L L+ HL G Sbjct: 186 TDAMKLPYLILALLLLAIAVVFVFSKLPKIGDEGAEPASGKKEKLIDFDVLKRSHLRWGV 245 Query: 253 VGIFVYVGAEVSIGSFLVNFLGEAHIVGMPEEQAAHYIAYYWGGAMVGRFIGSAVMQKI- 311 + F Y G + +I S + + G+PE+ A + Y ++GR+IG+ +M K Sbjct: 246 IAQFFYNGGQTAINSLFLVYC--CTYAGLPEDTATTFFGLYMLAFLLGRWIGTGLMVKFR 303 Query: 312 PAGTVLAFNAFMAALLVLVAMTTSGSVAMWAILGVGLFNSIMFPTIFSLALRDLGPHTSQ 371 P G +L + A M LL V M G + ++A+L + F SIM+PT FSLAL+ LG T Sbjct: 304 PQGMLLVY-ALMNILLCGVVMLWGGMIGLYAMLAISFFMSIMYPTQFSLALKGLGNQTKS 362 Query: 372 GSGILCLAIVGGAIVPLLQGVL--ADNLGIQLAFILPVVCYGFILFYGAKGSKM 423 GS L +AIVG A +P L + +A+ +P++C+ F +YG KG K+ Sbjct: 363 GSAFLVMAIVGNACLPQLTAYFMHVNEHIYYVAYGIPMICFAFCAYYGWKGYKV 416 Lambda K H 0.326 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 418 Length adjustment: 32 Effective length of query: 391 Effective length of database: 386 Effective search space: 150926 Effective search space used: 150926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory