Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 350819 BT1291 spermidine/putrescine transport ATP-binding protein (NCBI ptt file)
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Btheta:350819 Length = 463 Score = 145 bits (367), Expect = 1e-39 Identities = 85/212 (40%), Positives = 127/212 (59%), Gaps = 8/212 (3%) Query: 2 SSVSIQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHAT 61 S + + VS+ F G +T AL V V+ +FVTILGPSGCGK+TLLR++AG A+ Sbjct: 8 SIIEVSHVSKFF----GDKT-ALDDVTLNVKKGEFVTILGPSGCGKTTLLRLIAGFQTAS 62 Query: 62 SGRVLLDGAPV-EGPGAERGM--VFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAY 118 G + + G + + P +R + VFQ Y LFP L + NI FGL+ + P+ ++ Sbjct: 63 EGEIRISGKEITQTPPHKRPVNTVFQKYALFPHLNVYDNIAFGLKLKKTPKQTIGKKVKA 122 Query: 119 FIAKVGLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELL 178 + VG+ +E LSGG QQR AIARA+ N+P++LL+DEP ALD + R MQ L Sbjct: 123 ALKMVGMTDYEYRDVDSLSGGQQQRVAIARAIVNEPEVLLLDEPLAALDLKMRKDMQMEL 182 Query: 179 LGIWEAERKTVLFVTHDIDEAIFMANRVAVFS 210 + ++ T ++VTHD +EA+ +++ + V S Sbjct: 183 KEMHKSLGITFVYVTHDQEEALTLSDTIVVMS 214 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 463 Length adjustment: 29 Effective length of query: 230 Effective length of database: 434 Effective search space: 99820 Effective search space used: 99820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory