Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate 350849 BT1321 putative phosphate transport ATP-binding protein (NCBI ptt file)
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Btheta:350849 Length = 252 Score = 129 bits (324), Expect = 6e-35 Identities = 88/240 (36%), Positives = 132/240 (55%), Gaps = 16/240 (6%) Query: 18 FGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEP-ISGGRLEVAGVDLSGAK 76 +G L+G++ +I K V++ IGPSGCGKSTFLR NR+ I RLE + + G Sbjct: 15 YGDFHALKGISMQIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLE-GEIRIDGHN 73 Query: 77 IDQKHLR--QLRVRVGMVFQHFNLFPHLTVLQNLLLAPR-------KVLRIPMAEAKDRA 127 I K + +LR VGMVFQ N FP ++ +N+ R +R + E A Sbjct: 74 IYAKGVEVDELRKNVGMVFQRPNPFPK-SIFENVAYGLRVNGVKDNAFIRQRVEETLKGA 132 Query: 128 LTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLN 187 + D+V K Y LSGGQ+QR+ IAR + + P +LL DEP SALDP +V Sbjct: 133 ALW-DEVKDKLKESAYA--LSGGQQQRLCIARAMAVSPSVLLMDEPASALDPISTAKVEE 189 Query: 188 VMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAFLS 247 ++ +L ++ T+ +VTH MQ A VS++ FF G + E D ++F NP+ + + +++ Sbjct: 190 LIHELKKD-YTIVIVTHNMQQAARVSDKTAFFYLGEMVEYDDTKKIFTNPEKEATQNYIT 248 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 252 Length adjustment: 24 Effective length of query: 228 Effective length of database: 228 Effective search space: 51984 Effective search space used: 51984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory