Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 351279 BT1751 Glycine betaine transport ATP-binding protein (NCBI ptt file)
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__Btheta:351279 Length = 408 Score = 317 bits (811), Expect = 4e-91 Identities = 152/265 (57%), Positives = 212/265 (80%) Query: 6 ISKIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMG 65 +SKIE+K+++ +FGN ++AL+++++ KTK ++L TGC V V D +LSI GEIFVIMG Sbjct: 1 MSKIEIKDLYLVFGNEKQKALKMLKEGKTKSEILKATGCTVAVKDANLSINEGEIFVIMG 60 Query: 66 LSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHK 125 LSGSGKSTL+R NRLI PTSG ++++G DI ++ L + RR +++MVFQ+FGLLPH+ Sbjct: 61 LSGSGKSTLLRCINRLIRPTSGEVIINGTDIAKVSDKELLQIRRKELAMVFQNFGLLPHR 120 Query: 126 SVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAA 185 SVL N+A+GL+++G K ++A+ + VGLKGYEN+ +LSGGM+QRVGLARALA Sbjct: 121 SVLHNIAFGLELQGVKKGEREQKAMESMQLVGLKGYENQMVSELSGGMQQRVGLARALAN 180 Query: 186 DTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDG 245 + +++LMDEAFSALDPLIR +MQD+LL LQ + KTIVFITHDL EA+++G+RIAI+KDG Sbjct: 181 NPEVLLMDEAFSALDPLIRVQMQDELLTLQSKMKKTIVFITHDLSEAIKLGDRIAIMKDG 240 Query: 246 KLIQVGTPREILHSPADEYVDRFVQ 270 +++Q+GT EIL PA+ YV+RFV+ Sbjct: 241 EIVQIGTSEEILTEPANAYVERFVE 265 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 408 Length adjustment: 28 Effective length of query: 248 Effective length of database: 380 Effective search space: 94240 Effective search space used: 94240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory