Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 353166 BT3640 lipoprotein releasing system ATP-binding protein (NCBI ptt file)
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Btheta:353166 Length = 218 Score = 121 bits (303), Expect = 1e-32 Identities = 70/181 (38%), Positives = 103/181 (56%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 L + L+I G+I I+G SG+GK+TL++ + L EP +G V DG + + K L AF Sbjct: 17 LKGIDLEINKGEIVSIVGPSGAGKTTLLQIMGTLDEPDAGTVAIDGTVVSRMKEKELSAF 76 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPH 162 R + + VFQ L+P T L+NV+ + GVS +A E M+ + +GL+ + P+ Sbjct: 77 RNKNIGFVFQFHQLLPEFTALENVMIPAFIAGVSSKEANERAMEILAFMGLTDRASHKPN 136 Query: 163 QLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITH 222 +LSGG KQRV +ARAL VIL DE +LD + D+ L+ L +T V +TH Sbjct: 137 ELSGGEKQRVAVARALINHPAVILADEPSGSLDTHNKEDLHQLFFDLRDRLGQTFVIVTH 196 Query: 223 D 223 D Sbjct: 197 D 197 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 218 Length adjustment: 24 Effective length of query: 251 Effective length of database: 194 Effective search space: 48694 Effective search space used: 48694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory