Align BadK (characterized)
to candidate 354228 BT4702 dihydroxynapthoic acid synthetase (NCBI ptt file)
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Btheta:354228 Length = 274 Score = 102 bits (254), Expect = 8e-27 Identities = 82/253 (32%), Positives = 115/253 (45%), Gaps = 4/253 (1%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAG-NTRAFAAG 64 IL + + IT+NR NA + AL + I IVI G +AF +G Sbjct: 16 ILFDYYNGIARITINRERYRNAFTPTTTAEMSDALRICREEADIDVIVITGAGDKAFCSG 75 Query: 65 AD--IASMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIA 122 D + + D + + IR I KPV+AAV G A GGG L + CD+ IA Sbjct: 76 GDQNVKGRGGYIGKDGVPRLSVLDVQKQIRSIPKPVIAAVNGFAIGGGHVLHVVCDLSIA 135 Query: 123 GRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVD 182 +A F ++G G L R +G+ KA ++ R NA+EA GLV++VV Sbjct: 136 SENAIFGQTGPRVGSFDAGFGASYLARVVGQKKAREIWFLCRKYNAQEALDMGLVNKVVP 195 Query: 183 DDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADARE 242 ++L DE V A + S AL +K LN + L L + + +A+E Sbjct: 196 LEQLEDEYVQWAEEMMLLSPLALRMIKAGLNAELDGQAGIQELAGDATL-LYYLTDEAQE 254 Query: 243 GIQAFLEKRAPCF 255 G AFLEKR P F Sbjct: 255 GKNAFLEKRKPNF 267 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 274 Length adjustment: 25 Effective length of query: 233 Effective length of database: 249 Effective search space: 58017 Effective search space used: 58017 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory