Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate 351439 BT1911 7-alpha-hydroxysteroid dehydrogenase (NCBI ptt file)
Query= metacyc::MONOMER-16230 (256 letters) >FitnessBrowser__Btheta:351439 Length = 259 Score = 134 bits (338), Expect = 1e-36 Identities = 89/253 (35%), Positives = 137/253 (54%), Gaps = 9/253 (3%) Query: 5 DKTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTAIAVG 64 +K V++TGA+ GIG A R +G +VVI +D + A LA E+ G + Sbjct: 6 NKVVVITGAAGGIGEATTRRIVSEGGKVVI----ADLSQERADKLAAELTQAGADVRPIY 61 Query: 65 ADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLDMPR---ELYLKTVGTNLNGA 121 A +L S ++LV A++ +G +DVL+NN G L++ + + + + NL Sbjct: 62 FSATELQSCKELVDFAMKEYGQIDVLINNVGGTDPKRDLNIEKLDIDYFDEVFHLNLCCT 121 Query: 122 YFTVQAAARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPYG 181 + Q M G GG I+ V+SIS L A T Y +KAG+++L + A +G Sbjct: 122 MYLSQQVIPIMTTHG-GGNIVNVASISGLTADANGTLYGASKAGVINLTKYIATQMGKKN 180 Query: 182 IRCNAVLPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYVT 241 IRCNAV PG + T ++L++ E R + LGEP+D+A I FLAS+ ARY+T Sbjct: 181 IRCNAVAPGLVLTPAALDNLNE-EVRNIFLGQCATPYLGEPEDVAATIAFLASNDARYIT 239 Query: 242 GASLLVDGGLFVN 254 G +++VDGGL ++ Sbjct: 240 GQTIVVDGGLTIH 252 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 259 Length adjustment: 24 Effective length of query: 232 Effective length of database: 235 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory