Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate 352759 BT3232 gluconate 5-dehydrogenase (NCBI ptt file)
Query= metacyc::MONOMER-16231 (254 letters) >FitnessBrowser__Btheta:352759 Length = 267 Score = 118 bits (296), Expect = 1e-31 Identities = 82/252 (32%), Positives = 126/252 (50%), Gaps = 8/252 (3%) Query: 4 LEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAVKG 63 L+GK LVTGAS GIG A A A+ GA V N + + + A E G +A Sbjct: 9 LKGKVALVTGASYGIGFAIASAYAEQGATVCFNDINQELVDKGMAAYAEK-GIKAHGYVC 67 Query: 64 DVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPVDVVERTFKVNLHGAYFMV 123 DV D Q VA + G +D++V+NAGI +M R ++L+ + + Sbjct: 68 DVTDEPAVQAMVATIEKEVGTIDILVNNAGIIRRVPMHEMEAADFRRVIDIDLNAPFIVS 127 Query: 124 QAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGKHGIRCN 183 +A M+++ G I+ + S+ + +G E + Y K G+ L ++ G++ I+CN Sbjct: 128 KAVLPAMMKK-RAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNICSEYGEYNIQCN 186 Query: 184 SVLPGTILTEIN---KDDLADQEKR---EYMEARTPLGRLGAPEDLAGPIVFLASDMAAY 237 + PG I T ++ AD + ++ A+TP GR PE+L GP VFLAS+ + Sbjct: 187 GIGPGYIATPQTAPLREKQADGSRHPFDSFICAKTPAGRWLDPEELTGPAVFLASEASNA 246 Query: 238 VTGAALLVDGGM 249 V G L VDGG+ Sbjct: 247 VNGHVLYVDGGI 258 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 267 Length adjustment: 24 Effective length of query: 230 Effective length of database: 243 Effective search space: 55890 Effective search space used: 55890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory