Align 2-deoxy-3-keto-D-ribonate cleavage enzyme (characterized)
to candidate H281DRAFT_03174 H281DRAFT_03174 Uncharacterized conserved protein, DUF849 family
Query= reanno::Burk376:H281DRAFT_00641 (312 letters) >FitnessBrowser__Burk376:H281DRAFT_03174 Length = 309 Score = 160 bits (406), Expect = 3e-44 Identities = 106/319 (33%), Positives = 159/319 (49%), Gaps = 47/319 (14%) Query: 5 SRKVIISCAITGATHVPSMSEFLPITPEQIRDQAIEAAQAGAAIIHLHARDPVDGRPTPS 64 + +VI++CA+TGA +P+TP QI + AIEAA+AGA + H H RDP GR + Sbjct: 2 NHEVIVTCAVTGAGDTVGKHPAIPVTPRQIAEAAIEAAKAGATVAHCHVRDPKTGRGSRD 61 Query: 65 PEIFKAFVPAI-AEATDAVINITTGGSTRMTLE------------------ERLAYPRLA 105 P++++ V I + TD +IN+T G + + RLA+ Sbjct: 62 PQLYREVVDRIRSSGTDVIINLTAGMGGDLEIGPGEDPMRFGANTDLVGGLTRLAHVEEL 121 Query: 106 RPEMCSLNMGSMNFSIHPVAAKISSWRYGWEKDYIEGMEDMIFRNTFRDIRNILLELGES 165 PE+C+L+ G++NF G D I+ +T +R + E Sbjct: 122 LPEICTLDCGTLNF----------------------GDGDYIYVSTPAQLRAGAARIQEL 159 Query: 166 GTRFEFECYDVGHLYNLAHFVDQGLVKPPFFIQSVFGILGGLGADPENMLLMRSTADRLF 225 G + E E +D GHL+ + +GL+ P Q GI G AD M++ AD L Sbjct: 160 GVKPELEIFDTGHLWFAKQLLKEGLLDAPPLFQLCLGIPWGAPADTTT---MKAMADNL- 215 Query: 226 GRENYHFSVLGAGRHQMPLVTMSAIMGGNVRVGLEDSVYLAKGVKAETNAQQVRKIRRIL 285 ++ G GR QMP+V + ++GG+VRVGLED+++L KGV A TN V++ I+ Sbjct: 216 -PPGAQWAGFGIGRMQMPMVAQAMLLGGHVRVGLEDNIWLDKGVPA-TNGTLVQRAVEII 273 Query: 286 EELSLEIATPADARKMLGL 304 E L TPA+ R+ LGL Sbjct: 274 ERLGGRALTPAEGRRKLGL 292 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 309 Length adjustment: 27 Effective length of query: 285 Effective length of database: 282 Effective search space: 80370 Effective search space used: 80370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory