GapMind for catabolism of small carbon sources

 

Protein CCNA_02006 in Caulobacter crescentus NA1000

Annotation: FitnessBrowser__Caulo:CCNA_02006

Length: 228 amino acids

Source: Caulo in FitnessBrowser

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med ABC transporter for L-Arginine, putative ATPase component (characterized) 40% 86% 147.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 40% 82% 144.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 40% 65% 161.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 39% 87% 146.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 38% 90% 136.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 36% 90% 134.8 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 34% 86% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 33% 84% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 33% 84% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 34% 86% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 33% 84% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 33% 84% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 213.4

Sequence Analysis Tools

View CCNA_02006 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSDPVLALRGLERVYKTEAGDLPVLRGVDLDVYPGEVVGLIGPSGSGKSSLLHSAGLLER
PDAGLVALEGRDCSKLSERARTRIRLGTVGFVYQFHHLLPEFSALENVAMPLTIAGKSRR
EAEARARELLESLGLGHRLNHQPAQMSGGEQQRVAIARALANRPKLLLADEPTGNLDPAT
STAVFQALYQVCREQGVAAVIATHNMELARYMDRVVALKDGHLELQRV

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory