Align D-tagatose-1,6-bisphosphate aldolase subunit GatY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 (characterized)
to candidate CCNA_03360 CCNA_03360 tagatose-1,6-bisphosphate aldolase
Query= SwissProt::P0C8J6 (284 letters) >FitnessBrowser__Caulo:CCNA_03360 Length = 363 Score = 154 bits (388), Expect = 4e-42 Identities = 109/326 (33%), Positives = 164/326 (50%), Gaps = 45/326 (13%) Query: 4 VSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLL 63 ++ +Q+L++A Y +PAFNI+N+E ++E A +++PVII + G +A L Sbjct: 4 ITLRQLLDHAAEHEYGLPAFNINNMEQGLAIMEAADAVNSPVIIQASRGARNYANDIMLA 63 Query: 64 ALVSAMAKQYHH-PLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQ-------NIS 115 ++ A+ Y H P+ +H DH A ++ G SVM+D S + A+ N+ Sbjct: 64 KMIDALVDIYPHIPVCMHQDHGNGPATCATAIQYGFTSVMMDGSLMEDAKTPASYEYNVE 123 Query: 116 RVKEVVDFCHRFDVSVEAELGQLG------GQEDDVQVNEA----DALYTNPAQAREFAE 165 ++VV H VSVE ELG LG G+ +D E D L T+P QA +F Sbjct: 124 VTRKVVQMAHSCGVSVEGELGVLGSLETGMGEAEDGHGFEGKLSHDELLTDPDQAVDFVA 183 Query: 166 ATGIDSLAVAIGTAHGMYA-----SAPALDFSRLENI-RQWVNLPLVLHGAS-------- 211 TG+D+LA+A+GT+HG Y L + +E I R+ N LV+HG+S Sbjct: 184 QTGVDALAIAMGTSHGAYKFTRKPDGDVLAMNVIEEIHRRLPNTHLVMHGSSSVPQDLQD 243 Query: 212 -------------GLSTKDIQQTIKLGICKINVATELKNAFSQALKNYLTEHPEATDPRD 258 G+ ++IQ+ IK G+ KINV T+ + A + A++ L E P DPR Sbjct: 244 IINQYGGEMPQTWGVPVEEIQRGIKHGVRKINVDTDNRMAITGAIRKLLVEKPGEFDPRA 303 Query: 259 YLQSAKSAMRDVVSKVIADCGCEGRA 284 YL+ AK AMR V + G G A Sbjct: 304 YLKPAKEAMRKVCQARFVEFGSAGHA 329 Lambda K H 0.318 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 363 Length adjustment: 28 Effective length of query: 256 Effective length of database: 335 Effective search space: 85760 Effective search space used: 85760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory