GapMind for catabolism of small carbon sources

 

Alignments for a candidate for ptsB in Caulobacter crescentus NA1000

Align PTS system N-acetylglucosamine-specific EIIB component; PTS system GlcNAc-specific EIIB component; N-acetylglucosamine-specific phosphotransferase enzyme IIB component; GlcNAc-specific phosphotransferase enzyme IIB component; EC 2.7.1.193 (characterized)
to candidate CCNA_00572 CCNA_00572 PTS system, N-acetylglucosamine-specific IIBC component

Query= SwissProt::Q9S2H6
         (77 letters)



>FitnessBrowser__Caulo:CCNA_00572
          Length = 582

 Score = 62.8 bits (151), Expect = 4e-15
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 8   IVAGLGGIDNIDEIEGCITRLRTEVNDPALVNEAALKAAGAHGVVK-MGTAIQVVIGTDA 66
           ++A LGG  N+  ++ C TRLR  V D  LVNE ALKA GA GVV+    A+QVV+G  A
Sbjct: 423 MLAALGGAANLVSVDACTTRLRLIVVDQGLVNEPALKALGARGVVRPSDKALQVVLGPIA 482

Query: 67  DPIAAEI 73
           D +A EI
Sbjct: 483 DTVAGEI 489



 Score = 50.4 bits (119), Expect = 2e-11
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MASKAEKIVAGLGGIDNIDEIEGCITRLRTEVNDPALVNEAALKAAGAHGVVKMGT-AIQ 59
           ++  A+ ++A LGG DN+ ++    +RLR  +NDP  V++AAL  AG  G   +   A+ 
Sbjct: 507 VSQAAKALLAALGGADNLRDLSVHASRLRVVLNDPERVDQAALHTAGVRGFAAVAPGAVH 566

Query: 60  VVIGTDADPIA 70
           ++IG  A+ IA
Sbjct: 567 IIIGPHAERIA 577


Lambda     K      H
   0.315    0.133    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 111
Number of extensions: 6
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 77
Length of database: 582
Length adjustment: 20
Effective length of query: 57
Effective length of database: 562
Effective search space:    32034
Effective search space used:    32034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory