Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate CCNA_01335 CCNA_01335 ABC-type multidrug transport system, ATPase component
Query= TCDB::Q8DQH7 (236 letters) >FitnessBrowser__Caulo:CCNA_01335 Length = 305 Score = 102 bits (255), Expect = 7e-27 Identities = 75/227 (33%), Positives = 115/227 (50%), Gaps = 13/227 (5%) Query: 4 LKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFL 63 L+ L+ YG ++A+ D S + G V ++G NGAGK+T+ R GLVRP+SG Sbjct: 5 LEAVGLTKTYGAVRALDDFSIAIPAGGVFGILGPNGAGKSTLFRIALGLVRPTSGSARLF 64 Query: 64 GQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRF 123 G + A + V G + + P P LT + L+M A E +A+ + Sbjct: 65 GAAPGDITALRKV-GAMIETP---RYPPYLTARDTLKMLAL-----ESGKAD-ADIGGWL 114 Query: 124 PRLEERKNQDAAT--LSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQD 181 R+ D AT S G +Q L + A ++ P+L++LDEP+ G+ P IQEI +I D Sbjct: 115 ERVSLTHAADRATSGFSVGMKQRLGLAAAFLTKPELVILDEPTSGMDPAGIQEIRALIID 174 Query: 182 IQK-QGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSE 227 + K +G TV+L ++ + DR +L GK+V G EL + E Sbjct: 175 LAKIEGVTVILASHQLDEVKRVCDRVAILSRGKVVAEGGVAELTAGE 221 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 305 Length adjustment: 25 Effective length of query: 211 Effective length of database: 280 Effective search space: 59080 Effective search space used: 59080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory