Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate CCNA_02751 CCNA_02751 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >FitnessBrowser__Caulo:CCNA_02751 Length = 332 Score = 100 bits (249), Expect = 4e-26 Identities = 70/231 (30%), Positives = 120/231 (51%), Gaps = 8/231 (3%) Query: 1 MLQFENVSTFY--GKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSI 58 M+ F++VS Y G AL V++ V+ GE+ +IGA+GAGKSTL+ + G +G + Sbjct: 1 MITFQDVSKTYAQGGHPALSGVSLSVKAGEVFGVIGASGAGKSTLIRLINGLETPSAGQV 60 Query: 59 RYMGEEL--VGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKV 116 G+++ +G +R+ + ++ + + + TV +N+A + E + Sbjct: 61 IVDGDDVAALGVAGLRALRRRVGMIFQHFNLLSGKTVAQNVAFPLKLAGR-PAAEVKART 119 Query: 117 LHLFPR--LKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFD 174 L R L + +SGG++Q + I RAL + PK+LL DE + L P +QI D Sbjct: 120 AELLERVGLSAHAGKYPAQLSGGQKQRVGIARALATNPKVLLCDEATSALDPETTEQILD 179 Query: 175 IIEQLRKD-GVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDP 224 +I L ++ G+T+ L+ + ++ DR VL+ GRVV +G E + P Sbjct: 180 LIAGLNRELGLTIVLITHEMDVVRRVCDRVAVLDAGRVVEEGAVEEVFLHP 230 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 332 Length adjustment: 25 Effective length of query: 208 Effective length of database: 307 Effective search space: 63856 Effective search space used: 63856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory